KEGG   Dyella sp. M7H15-1: EO087_04725Help
Entry
EO087_04725       CDS       T05846                                 

Gene name
purE
Definition
(GenBank) 5-(carboxyamino)imidazole ribonucleotide mutase
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00230  Purine metabolism
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
Module
dye_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EO087_04725 (purE)
Enzymes [BR:dye01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     EO087_04725 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC
Motif
Other DBs
NCBI-ProteinID: QAU23370
UniProt: A0A410UGE9
Position
complement(983358..983861)
Genome map
AA seq 167 aa AA seqDB search
MTVTTAAPKVGVVMGSRSDWETMTHAAEVLQELGVPHEVRVVSAHRTPDLLFQYAEEAVG
RGIQVIIAGAGGAAHLPGMLAAKTRLPVLGVPVQSKALQGMDSLLSIAQMPAGIPVGTLA
IGRAGAVNAGLLAAAVLALHDPVLAKAVDIYRSRQTQAVLDNSDPRA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacggtaacaacggcagcaccgaaagttggtgtggtgatgggatcgcgttcggattgg
gaaaccatgacgcatgcggccgaagtgctacaggaactgggcgtgccccacgaggtacgg
gtggtttccgcacaccgcacgccggacttgctgttccagtacgccgaagaggccgttggt
cgcggtatccaggtcatcattgctggcgccggtggcgcagcccatctgccgggcatgctg
gctgccaagacccgcttgccagtgcttggcgttccggtgcagtccaaggcccttcagggc
atggactccctgctttccatcgcgcagatgccggccggcattccggtgggcaccctggcg
atcggtcgcgcgggtgcagtcaatgcgggcctgctcgcggccgcagtgcttgcgttgcac
gatccggtgctggcaaaggccgtggatatctatcgttcccgtcagactcaggccgttctg
gacaactcggatccccgcgcgtga

DBGET integrated database retrieval system