KEGG   Dyella sp. M7H15-1: EO087_04980Help
Entry
EO087_04980       CDS       T05846                                 

Definition
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00220  Arginine biosynthesis
dye00250  Alanine, aspartate and glutamate metabolism
dye00270  Cysteine and methionine metabolism
dye00330  Arginine and proline metabolism
dye00350  Tyrosine metabolism
dye00360  Phenylalanine metabolism
dye00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dye00401  Novobiocin biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
dye01210  2-Oxocarboxylic acid metabolism
dye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EO087_04980
   00270 Cysteine and methionine metabolism
    EO087_04980
   00220 Arginine biosynthesis
    EO087_04980
   00330 Arginine and proline metabolism
    EO087_04980
   00350 Tyrosine metabolism
    EO087_04980
   00360 Phenylalanine metabolism
    EO087_04980
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EO087_04980
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    EO087_04980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dye01007]
    EO087_04980
Enzymes [BR:dye01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     EO087_04980
Amino acid related enzymes [BR:dye01007]
 Aminotransferase (transaminase)
  Class I
   EO087_04980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Oxidored_nitro Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: QAU23412
UniProt: A0A410UGX3
Position
complement(1037584..1038783)
Genome map
AA seq 399 aa AA seqDB search
MPQLAQRVGRAKPSAIMVIAETAKQLKAAGRDIISFSIGVPNFLPGEHVYVAAREALTHD
SGQYGSNRGSDALLDAFLKHIQALGFTGYGRMNLSIGMGAKQVLYNLAEALLNEGDEICF
AAPYWTTYHDIADIVGAKANVLHCDPAQNYKLTPQQLENALARKPKVFLFNNPSNPTGMV
YTREEIAALADVLVQYPDTWIVTDDIYNSMVFDGIGYHNFVFARPELRDRLIFVDSVSKT
YGMPGWRVGLIAGPESVAKAVTTLNSNHITSVPEVIAAAAIAAFSGPQDIPQVKCQEFSA
KRDIVLAALNKIPGVVCPRPQGAFYAFPDISVAFGKSHGDTRIENDVDFCAALLGAKSVA
CVPGSAFGESHAMRISYTCPTAQLDPGLARIVEFFAELS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctcgcccagcgtgtcggccgcgccaaacccagcgcgatcatggtcatcgcc
gaaacggcgaagcagctcaaagccgccggccgcgacatcatcagcttctccatcggcgtg
ccgaattttcttcctggcgaacacgtctatgtggcagcacgcgaagcgctcacacacgat
agcggccagtacggcagcaatcgcggctccgacgcactgttggatgccttcctcaaacac
atccaggcactgggttttaccggttacggccgcatgaacctgtcgatcggcatgggtgcc
aagcaggtgttgtacaacctggccgaggcgctgctcaacgaaggcgacgaaatctgcttt
gccgcgccgtactggaccacttatcacgacattgccgacattgtcggcgcgaaagccaat
gtgttgcattgcgacccggcacagaactacaaactgacgccgcagcagttggaaaatgca
ctggcgcgcaaaccgaaagtgttcctgttcaacaatccgtccaaccctaccggtatggtc
tacacgcgcgaggaaatcgccgcgctggccgacgtgctggtgcagtatccggatacttgg
atcgtcaccgacgatatctataactcgatggtgttcgacggtatcggttatcacaacttc
gtattcgcacggccagagttacgcgatcgcctaatctttgtcgactcggtgtccaagacc
tacggcatgccgggctggcgcgtgggtttgatcgctggcccagaatcggtggccaaggcg
gtcaccacactcaattccaaccacatcaccagcgtgccggaggtgatcgcggcggctgcc
atcgcggcattcagcggtccgcaggacattccgcaggtcaagtgccaggaattctcggcc
aagcgcgacatcgtgcttgctgcgctcaacaagattcccggtgtggtgtgtccgcgcccg
cagggtgcgttctacgctttcccggatatctcagtggccttcggcaagagccacggcgat
acgcgcatcgaaaacgatgtggatttctgcgctgcattgttgggggcgaagagtgtggcc
tgcgtgccgggttcggccttcggcgaatcgcacgctatgcgcatttcctatacttgtcct
accgcccagcttgaccccggccttgcccgtattgtcgagttcttcgctgaactgagctga

DBGET integrated database retrieval system