KEGG   Dyella sp. M7H15-1: EO087_05245Help
Entry
EO087_05245       CDS       T05846                                 

Definition
(GenBank) phosphoribosylanthranilate isomerase
  KO
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
dye01230  Biosynthesis of amino acids
Module
dye_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EO087_05245
Enzymes [BR:dye01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     EO087_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRAI
Motif
Other DBs
NCBI-ProteinID: QAU23460
UniProt: A0A410UGP0
Position
complement(1089276..1089914)
Genome map
AA seq 212 aa AA seqDB search
MTRIKCCGMTRVEDALLAAQLGADAIGVVMTAHSKRQVSLAQAKTIVDAMPPFVTTVVLC
MDDDAGFVQEVIDTIRPSLLQFHGGESDEWCRQFGHPYLKAIAMGEGACALYQLRDHPHA
AGLLLDGHGLGEAGGSGKAFDWSLMPCDLKQSLILAGGLTPANVAEAIRVAKPWAVDVSS
GIESAPGIKDPVKLRDFIAAVRLSVPGGSGHL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcaaatgctgcggcatgacccgcgtggaagacgccttgctcgccgcacag
cttggcgccgacgccattggcgtggtgatgaccgcgcacagcaaacggcaagtgtcgctg
gcacaggcgaagaccatcgtggatgccatgccgccattcgtcaccaccgtggtcctgtgc
atggacgatgacgcgggcttcgtacaggaagtcatcgacaccatccgtccctcactgctg
cagtttcatggcggcgaaagcgacgaatggtgcaggcagttcggccatccgtacctcaag
gcgattgcgatgggggagggcgcttgcgcgctttatcaactgcgcgatcatccacatgct
gccggcttgctgctggatggtcacggcttgggcgaagcgggtggcagcggcaaggcgttc
gactggtcgctgatgccatgcgatctaaagcaatcgttgattctggcgggagggcttacg
ccagccaacgtcgctgaagcgattcgtgtcgccaaaccttgggcggtggatgtgtcgagt
ggtatcgagtccgcgccggggatcaaggatccggtcaagttgcgtgattttattgcggct
gttcgactttctgtacccggtggttcaggccatctgtga

DBGET integrated database retrieval system