KEGG   Dyella sp. M7H15-1: EO087_05265Help
Entry
EO087_05265       CDS       T05846                                 

Definition
(GenBank) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00260  Glycine, serine and threonine metabolism
dye00261  Monobactam biosynthesis
dye00270  Cysteine and methionine metabolism
dye00300  Lysine biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01210  2-Oxocarboxylic acid metabolism
dye01230  Biosynthesis of amino acids
Module
dye_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
dye_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EO087_05265
   00270 Cysteine and methionine metabolism
    EO087_05265
   00300 Lysine biosynthesis
    EO087_05265
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    EO087_05265
Enzymes [BR:dye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     EO087_05265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh Ldh_1_N Gp_dh_C
Motif
Other DBs
NCBI-ProteinID: QAU23464
UniProt: A0A410UGN8
Position
complement(1093513..1094541)
Genome map
AA seq 342 aa AA seqDB search
MSKKSSYKVAMVGATGAVGETLLSILVQREFPISELVPLASERSAGGKVEFAGKQVTVKN
LADYDFSGVDIAFFSAGGSVSRVHAPRAAEAGAVVIDNTSEFRYRDDIPLVVSEVNPHAI
AQYTTRGIIANPNCSTMQMLVALAPIHRAVGIERINVATYQSVSGAGRSGMEELGKQTAA
LLNFQDVEKTKFPKQIAFNVIPHIDDFQANGYTKEEMKMVWETRKILEDESIQVNPTAVR
VPVFYGHAEVVHIETRDKITAEQARELLENAEGVVVQDERKPGGYPTPVGDAAGQDPVFV
GRIREDISHDRGLDMWIVADNIRKGAALNAVQIAELLIGDYL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagagtagttacaaggtagccatggtaggcgcgactggcgccgtgggcgag
acgctgcttagtatcctggtccagcgcgaattcccgatcagcgaactggtgccgctggcc
agcgagcgttcggcgggtggcaaagtggaatttgccggcaaacaggtcaccgtgaaaaat
cttgccgactacgacttcagcggcgtggacatcgccttcttctcggccggtggttcagtg
agccgtgtgcatgccccgcgtgcggccgaggcgggtgcggtggtgatcgacaacacctcc
gaattccgttaccgggacgatatcccgctggtggtcagcgaagtaaaccctcacgccatc
gcgcaatacaccacgcgcggcatcatcgccaaccccaactgctctaccatgcagatgcta
gtggcgctggcgccgattcatcgcgccgtgggcatcgagcgcatcaacgtcgccacctat
cagtctgtctccggcgctggccgttcgggcatggaagaactgggcaagcagactgccgcg
ctgctcaatttccaggacgtagaaaagaccaagttccccaagcagattgccttcaacgtc
atcccgcacatcgacgacttccaggccaatggctacaccaaggaagaaatgaaaatggtg
tgggagacgcgcaagatcctggaagacgagtcaatccaggtgaacccgaccgccgtgcgc
gtgccggtgttttacggccatgccgaagtcgtgcatattgaaacgcgcgacaagatcacc
gccgagcaggcgcgcgagctactggaaaacgccgaaggcgtggtcgtgcaagatgagcgc
aagccgggcggctatcccacgccggtgggtgatgcggccggtcaggatccggtcttcgtg
ggccgcatccgcgaggacatctcgcacgaccgcggcctggatatgtggatcgtggcggat
aacattcgcaagggcgcggcgctcaatgccgtgcagatcgccgagttgttgatcggggat
tacctgtaa

DBGET integrated database retrieval system