KEGG   Dyella sp. M7H15-1: EO087_05270Help
Entry
EO087_05270       CDS       T05846                                 

Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
dye01230  Biosynthesis of amino acids
Module
dye_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EO087_05270
Enzymes [BR:dye01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     EO087_05270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt Nfu_N
Motif
Other DBs
NCBI-ProteinID: QAU23465
UniProt: A0A410UGS5
Position
complement(1094673..1095761)
Genome map
AA seq 362 aa AA seqDB search
MSSNSTGKLFTVTTFGESHGPAIGCVIDGCPPGLPIDAEEFRPDLERRATGRSRHTSQRR
EADEVEILSGVYQGLTTGTPIALLVRNTDQRSKDYGDIVETFRPGHADYTYWQKYGIRDP
RGGGRSSARETTMRVAAAVIAKKWLAERYGVRVRGYLAQLGEVVPEGFDWNEVEQNPFFW
PHEAQVPALEKYMDALRKSGDSVGARVNVQAQGVPPGWGEPIYGKLDGDLAAALMSINAV
KGVEVGDGFATVTQRGSQHRDEMQMDGFTSNHAGGILGGISTGQVVCASIALKPTSSILI
PGHSVNLAGERVEVVTKGRHDPCVGIRATPIAEAMMALVLMDHALRHRAQCGDVGEIIPR
IP
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagcaactccaccggcaagctcttcactgtcaccacgtttggcgaaagccatggt
ccagccattggctgcgtgatcgatggttgtccgccgggcttgccgatcgatgccgaggaa
tttcgccccgatctcgagcgtcgcgcaacgggccgcagtcgtcatacctcgcagcgccgc
gaagcggatgaggtggaaattctttcgggtgtgtaccaggggctcaccaccggtacgccg
atcgccctgctggttcgcaataccgaccagcgtagcaaggattacggcgacatcgttgaa
acgtttcgccccggccatgccgactacacctattggcagaagtacggcattcgcgatccg
cgtggcggtggccgctcttccgcgcgtgaaaccaccatgcgcgtggcggcggcggtgatc
gccaaaaaatggctggccgagcgctacggtgtgcgtgttcgcggttatctggctcagctc
ggcgaggtagtgccggaaggtttcgactggaatgaagtcgaacaaaatccgttcttctgg
ccgcacgaggcgcaagtgccggcgctggagaaatacatggatgcgctgcgcaagtcaggt
gattcagtcggtgcgcgcgtgaatgtccaagcgcaaggcgtgccgccgggctggggtgag
ccgatctacggcaagctggatggcgacttggccgccgcgctgatgtccatcaatgcagtc
aagggcgtggaggtcggcgatggtttcgctaccgtaacccagcgtggcagccagcatcgc
gatgaaatgcagatggacggctttacgtccaatcatgcggggggcattctggggggcatc
agtacgggtcaggtggtgtgtgcctcgatcgcgctcaaacccacgtcgagcatcttgatc
cccggtcatagcgtgaatctggccggtgagcgggttgaggtggtcaccaaggggcgtcat
gacccttgcgtcggcattcgtgccacacccattgccgaagcgatgatggcgttggtgttg
atggatcacgccttgcgccatcgtgcgcagtgtggcgatgtgggtgagataataccgcgt
attccctga

DBGET integrated database retrieval system