KEGG   Dyella sp. M7H15-1: EO087_05710Help
Entry
EO087_05710       CDS       T05846                                 

Definition
(GenBank) aminodeoxychorismate/anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
dye01230  Biosynthesis of amino acids
dye02024  Quorum sensing
Module
dye_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EO087_05710
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    EO087_05710
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EO087_05710
Enzymes [BR:dye01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     EO087_05710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: QAU23544
UniProt: A0A410UGW6
Position
complement(1184715..1185314)
Genome map
AA seq 199 aa AA seqDB search
MLLMIDNYDSFTFNLVQYLGELGQEVKVVRNDAMDVAGIRALKPSHIMISPGPGTPYDAG
VSLNVLRELVGEIPVFGVCLGHQAIGQAFGGKVVRAKHIMHGKTSPVRHLGKGVFAGLPD
SFEATRYHSLVVEQSSLPDCLEVTAWTENPDGSIDEIMGLRHKTLAVEGVQFHPESILTQ
YGHDLLRNFLRQPLQKLAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgatgatcgacaattacgacagcttcaccttcaacctcgtgcaatacctcggc
gagttgggacaggaggtgaaggtggtgcgcaatgatgcgatggacgttgccggcatccgt
gcgttgaagccgtcacatatcatgatttcgcctggcccggggacaccgtatgatgccggc
gtttcgctgaatgtgctgcgcgaattggtgggtgagatcccggtgtttggtgtctgtctt
gggcatcaggccatcggacaggccttcggcggcaaggtggttcgcgccaagcacatcatg
catggcaagacctcgccggtgcgccatctgggcaagggcgtgttcgccggattgccggat
tcgttcgaagccacgcgttatcactcgttggtggtggagcaatcttcgctgcccgattgc
ctggaagtcaccgcctggacggaaaaccccgacggctccatcgacgagatcatgggcctg
cgccacaagacgctggcggtggagggggtgcaattccatcccgagtcgattctcacccag
tacggtcatgacctgctacgtaacttccttcggcaaccgttgcaaaagctcgccgcatga

KEGG   Dyella sp. M7H15-1: EO087_05735Help
Entry
EO087_05735       CDS       T05846                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
dye01230  Biosynthesis of amino acids
dye02024  Quorum sensing
Module
dye_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EO087_05735
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    EO087_05735
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EO087_05735
Enzymes [BR:dye01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     EO087_05735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: QAU23548
UniProt: A0A410UH71
Position
complement(1191471..1192946)
Genome map
AA seq 491 aa AA seqDB search
MISRDEFEALAVQGHTRIPLVREVFSDLDTPLSVYLKLADGPYTFLFESVEGGATWGRYS
IISLPAKRVYRLRGHELEVEDAGEMVERRYLDDPLAEIENLRKQYDVPRLPQLPAFSGGL
VGYFGFETIGYIEPRLAQWDREDELGTPDVLLMLAEEVAVFDNLKGRLYLIVHADPSQPQ
AYVHAQRRLDALTHRLRQGGAPYPQLTQSTVLDEGDFKSSFTREAFEAMIERAKEYIRAG
DIFQVVPSQRLSVGFHARPVDVYRALRAMNPSPYMYFVDVGDTQIVGSSPEILARLQNGH
VVVRPIAGTRKRGDTEEEDQALEAELLADPKERAEHVMLIDLGRNDIGRISETGSVEVSE
SFVVERYSHVMHIVSQVQGKVTPGLSYMDVLKATFPAGTVSGAPKIRALEIIQELEPYKR
NIYAGAIGWIGWWGDADTAIAIRTAVIQGGRLHVQAGAGIVYDSDPASEWEETMNKGRAL
FRAVAQAAKGL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccgtgacgaattcgaagcacttgccgtgcaaggacacacccgcatcccactg
gtacgcgaagtgttctccgacctggatacgcccttgtcggtctaccttaagctggccgat
ggcccatacacctttttgttcgagtcggtggagggtggtgcgacgtgggggcgttattcg
atcatcagtttgccggccaagcgcgtgtatcgccttcgcggtcacgagttggaggtggag
gatgccggtgaaatggtcgagcgtcgttacctggatgatccgttggccgagatcgaaaac
ctgcgcaagcagtacgatgtgccgcgcctaccacaattgccggctttcagcggcggactg
gtaggttatttcggtttcgaaaccatcggctatatcgagccgcgcctggcacagtgggat
cgcgaggatgaactgggtacgcccgatgtgttgctgatgctggccgaggaagtggctgtc
ttcgataacctcaagggtcgtctctacctgatcgtgcatgccgatccgtcacaaccgcag
gcgtacgtacatgcgcaacgccggctggatgcgttgacgcatcggctgaggcagggtggt
gcgccttatccgcagctcacgcaatccactgtgctggacgaaggcgattttaaatcctcc
ttcacgcgcgaagcattcgaggcgatgatagagcgtgcgaaggaatacattcgcgcgggc
gatatttttcaggtggttccatcacaacgcttgagcgtgggtttccatgcacgtccggtg
gatgtgtatcgtgccttgcgtgcgatgaatccctcgccttacatgtatttcgtcgatgtg
ggcgatacgcagatcgtgggctcctcgcccgagattcttgcccgtctgcagaacggccat
gtggtggtgcgtccgattgccggtacgcgcaagcggggtgacaccgaggaagaggatcag
gcactcgaagcggaattgctggctgatcccaaggagcgtgctgaacacgtcatgttgatc
gatctgggccgtaacgatatcggtcgcatcagcgagacaggtagcgttgaagtgagcgaa
tccttcgtggtcgagcgctattcgcacgtcatgcacatcgtgtcgcaggtgcaaggcaag
gtgacacctggccttagttatatggatgtgctcaaggctacgttcccggcggggacagtc
agtggcgcgcccaagattcgcgcactggaaatcatccaggaactggaaccctacaagcgc
aacatctatgccggcgcgatcggctggatcggctggtggggcgacgcggacaccgctatc
gccattcgcacagccgttattcagggcggccgcttgcacgtacaggctggcgctggcatt
gtctacgattccgatcccgcttccgaatgggaagagacaatgaacaaggggcgtgcgttg
ttccgtgccgtggcacaagcagccaaaggcctgtga

KEGG   Dyella sp. M7H15-1: EO087_07685Help
Entry
EO087_07685       CDS       T05846                                 

Definition
(GenBank) aminodeoxychorismate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
dye01230  Biosynthesis of amino acids
dye02024  Quorum sensing
Module
dye_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EO087_07685
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    EO087_07685
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EO087_07685
Enzymes [BR:dye01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     EO087_07685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: QAU25426
UniProt: A0A410UMH8
Position
complement(1635973..1637313)
Genome map
AA seq 446 aa AA seqDB search
MHRAFAGRRDLLAPAAAFPERYPALLESVTQGSAHARYDMLFAFPQATLTLAADGCVRDA
EGQVHSGRFLDALDAAWRAERLPHGPDDGLPFHGGWVLLLAYELAAQIEPSLRLHHPQHL
PVAQAVRCPAAIIVDYVHERTILVAEAGQERLLDAMAADLDAMPLMPPLTVPDAMEEDAP
SLFLDGVARIHEHLHAGDIFQVNLSRAWHAHFTEAPTAASLYAALRRANPAPFAGMLQQK
DWAVVSSSPERLVEVRRGLVQTRPIAGTRPRVTGDDDLARIRELTAHPKERAEHVMLIDL
ARNDLGRVCRPGTVEVNELMVVESYAHVHHIVSNVRGRLRDGVTPGQVIAATFPGGTITG
CPKVRCMEIIAALEDAPRGAYTGALGYLDRDGDLDLNILIRTLTLQGHDVSLRAGAGIVA
DSMATKELDETRAKARGMLRALGVAG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
attcatcgtgcgtttgccggccggcgcgatctgctcgcgccggccgctgcatttccggag
cgctatcctgcgttgctcgaaagcgtcacgcagggtagtgcgcatgcacgctacgacatg
ctgttcgcgtttccgcaagctaccctcacgctggctgcggacggttgcgtgcgcgatgcc
gaaggccaagtgcattccggtcgttttcttgatgcattggatgcggcatggcgcgccgag
cgtttgccgcatggcccagacgatggattgcccttccacggcggctgggtgttgctgctc
gcctatgagttggctgcgcagatcgagccaagcttgcgtctacaccatccacaacacttg
ccggtggcgcaggcagtgcgttgcccggcggcgatcattgtcgattacgtgcatgagcgc
accatcctggtcgctgaggcgggacaggaacgcttgttggatgcgatggcagcggatctg
gatgccatgccgctgatgccgccgctcacggtgcctgatgccatggaagaagacgcgccg
tcgctctttctggatggcgtggcgcgcattcacgaacacttgcatgccggcgatattttt
caagtgaacctgtcgcgcgcatggcatgcacactttaccgaagcgccgactgcggcaagc
ctttacgccgcactgcgtcgcgccaatcctgcgccgtttgcgggaatgctgcagcagaag
gactgggcggtggtcagttcttcaccggagcgcctggtcgaagtgcggcgtggcttggtg
caaacccggccgatcgccggcacgcggccgcgcgttaccggcgatgacgatctggcgcgc
atccgcgagcttaccgcgcaccccaaggagcgcgccgagcatgtcatgctaatcgatctg
gcgcgcaatgatctcggtcgcgtttgccggcccggcacggtcgaagtgaacgagctgatg
gtggtggaaagctacgcccacgtgcaccacatcgtttcaaatgtgcgaggtcgtttacgc
gacggcgtgacgccagggcaagtgatcgccgccacctttccaggcggcaccatcaccggt
tgccccaaggtgcgttgcatggagatcattgcggcgctggaagatgctccacgcggtgcc
tacaccggtgcgctgggttatctcgatcgcgatggcgacctcgatctgaacatcctcatc
cgcacactgaccctgcagggtcatgatgtaagtctgcgtgccggcgctggcatcgtggct
gattccatggcgaccaaagagctggacgaaacccgcgccaaggcgcgcggcatgctgcgc
gcactgggagtggccggctga

DBGET integrated database retrieval system