KEGG   Dyella sp. M7H15-1: EO087_06235Help
Entry
EO087_06235       CDS       T05846                                 

Gene name
argH
Definition
(GenBank) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00220  Arginine biosynthesis
dye00250  Alanine, aspartate and glutamate metabolism
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
dye01230  Biosynthesis of amino acids
Module
dye_M00845  Arginine biosynthesis, glutamate => acetylcitrulline => arginine
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EO087_06235 (argH)
   00220 Arginine biosynthesis
    EO087_06235 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dye04147]
    EO087_06235 (argH)
Enzymes [BR:dye01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     EO087_06235 (argH)
Exosome [BR:dye04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EO087_06235 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-ProteinID: QAU23629
UniProt: A0A410UH63
Position
complement(1308259..1309554)
Genome map
AA seq 431 aa AA seqDB search
MTDLLWQKNGVETNAKIMKFLAGDDVLLDREFFLHDITASKAHVEGLAHIGVVSAQEMQD
LKRELDALVEDFRAGHFVLDDRYEDGHSAIEARLTDRLGDAGRRVHTGRSRNDQILVATR
LWLKEKLAELETHCHTIAEVCLQRAAQPALPLPGYTHLQRAVVSSTSMWFAGFAEGFVDN
AWRARQTEVWIDANPLGTAAGYGVNLPLDRAHTTQALGFSRMQVSPIYAQLSRGKFEMAV
MESIGSAMLDARRLAWDLSLFTTAEFNFVTLPSEYTTGSSIMPNKRNPDVVELLRASYAT
VAAARCEIEQLLSLPSGYQRDLQFSKGSLFHGVTHGLAALELLPDLLARMQWNETAMRAA
IEPAMYATDVAIEQAAAGVPFRDAYRAAAEAVTAAGQGRTPEASLAARTSPGAGNDLHLD
ALRQRLANLTT
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctcctttggcaaaaaaacggtgtcgagaccaacgctaagatcatgaagttc
ctggccggcgacgatgtgctgctggatcgcgaattcttcctgcatgacatcactgccagc
aaggcgcatgtcgaaggcttggcccatatcggagtggtcagcgcgcaagaaatgcaggat
ctcaaacgcgaactggatgcccttgtcgaggacttccgcgccggccattttgtactggac
gatcgttacgaagacggccattctgccatcgaagcgcgtctcaccgaccgacttggtgat
gccggtcgtcgcgtgcacaccggccgtagccgtaacgaccagattcttgtcgccacacgt
ttgtggctgaaggaaaagctcgccgaactggaaacgcattgccacaccattgccgaagta
tgcttgcagcgtgcagcccaaccggccttacccttgccgggctacacccacttgcagcgt
gcggtggtttcatcgacgtcgatgtggttcgccggctttgccgagggttttgtcgataac
gcatggcgtgcgcgtcagaccgaggtctggattgatgccaatccgctcggcaccgcagcc
ggttacggcgtgaatcttccgctcgatcgcgcccacaccacccaggcgcttggcttttcg
cggatgcaggtgtcgccgatctatgcccagctttcgcgcggcaagttcgaaatggccgtg
atggaaagcatcggcagcgccatgctcgatgcgcgccgtctggcctgggatctttcgctg
tttaccacagcggaattcaatttcgtcacgctgccgtccgaatacactaccggtagctcc
atcatgcccaacaagcgcaaccccgacgtggtggagctgctgcgtgcttcgtatgcaacc
gtcgccgccgcacgctgcgaaattgaacaactgctttcgttgccttcgggttatcaacgc
gacctgcaattttccaagggctcgctgtttcatggcgtgacacatggtcttgcagcgctc
gaactactgccagacctgcttgcacgcatgcaatggaacgaaaccgccatgcgcgccgcc
atcgaaccggccatgtatgccaccgacgtggccatcgagcaggccgccgcaggcgtgcct
ttccgtgacgcttatcgtgcagccgcggaagccgtcacggctgccgggcaggggcgcaca
cccgaagcgagcctggctgcgcgtacatcacctggtgccggcaacgatctgcacctggat
gcattacggcaacgtctcgccaacttgactacctga

DBGET integrated database retrieval system