KEGG   Dyella sp. M7H15-1: EO087_06240Help
Entry
EO087_06240       CDS       T05846                                 

Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00220  Arginine biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
dye01210  2-Oxocarboxylic acid metabolism
dye01230  Biosynthesis of amino acids
Module
dye_M00028  Ornithine biosynthesis, glutamate => ornithine
dye_M00845  Arginine biosynthesis, glutamate => acetylcitrulline => arginine
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    EO087_06240
Enzymes [BR:dye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     EO087_06240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh DapB_N GFO_IDH_MocA F420_oxidored
Motif
Other DBs
NCBI-ProteinID: QAU23630
UniProt: A0A410UH60
Position
complement(1309647..1310600)
Genome map
AA seq 317 aa AA seqDB search
MAASNKRIGIVGARGHTGAELIKLVAAHPSLELAYVSSRELDGQRVDEHVPEYQGDLHYT
SPAHEDLPSLDADVVVLALPNGKASVCVEAFDKAGKDPVIVDLSADYRFDNTWYYGLLEL
TRNQWRGEKRISNPGCYATAIQLSIAPLKGVLAAPPVCFGVSGYSGAGTTPSDKNNPEKL
RDNLMPYSLTGHMHEKEASRHLGIPVEFMPHVAPHFRGLTVTTNLYLARSHKHEDILALF
QRTYGDEKLVRVQDESPWVSQVAGKHHAEVGGFAVSADGKRVVIVATLDNLLKGAATQAM
QNINRAIGMDEYTSIPI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttccaacaagcgcatcggcatcgtaggtgctcgtggccacaccggcgcagaa
ctgatcaagctggtagctgcgcatccttcgctggaattggcgtacgtgtcgtcacgtgag
ctggatggtcagcgcgtggatgagcacgttcccgaataccagggcgatctgcattacaca
tcgccggcgcatgaagatctgcctagccttgatgcggatgtggtggtgctggctttgccc
aatggcaaggcgtcggtatgcgtcgaagccttcgacaaggccggcaaggatccggtgatc
gtggacctttctgccgattaccgcttcgataacacctggtactacggcctgttggaactc
acgcgcaaccaatggcgcggcgagaaacgcatcagcaatcccggctgctatgccaccgcg
atccagttgtccatcgcgccgctcaagggcgtgctggcagcaccgccggtgtgtttcggt
gtttccggttattctggcgcaggcaccactccgtcggacaagaacaatccggagaagctg
cgcgacaacctgatgccgtactccttgaccggacacatgcacgagaaggaagcgagccgc
cacctgggtatcccggtggaattcatgccgcatgtcgcaccgcattttcgtggcctgacc
gtcaccaccaatctgtaccttgctcgatcacacaagcacgaagatattcttgcgttgttc
cagcgaacctatggtgacgagaagctggtgcgcgtgcaggatgaatcgccgtgggtcagc
caggttgccggcaagcatcatgccgaggtgggtggctttgcggtgtcggcagacggcaag
cgtgtcgtcatcgttgctaccctggataaccttttgaaaggtgcggctacgcaggcgatg
caaaacatcaatcgggcgattggcatggacgagtacacctccattcccatttga

DBGET integrated database retrieval system