KEGG   Dyella sp. M7H15-1: EO087_06275Help
Entry
EO087_06275       CDS       T05846                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:dye00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EO087_06275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dye01007]
    EO087_06275
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dye03016]
    EO087_06275
Enzymes [BR:dye01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     EO087_06275
Amino acid related enzymes [BR:dye01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   EO087_06275
Transfer RNA biogenesis [BR:dye03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    EO087_06275
 Prokaryotic Type
    EO087_06275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: QAU23637
UniProt: A0A410UH62
Position
1317153..1318529
Genome map
AA seq 458 aa AA seqDB search
MPISLYNSLSRRIEPFAPLDPNRVTVYLCGPTVYSYVHIGNARGPVVFDVLVKLLRRHYP
QVIYARNITDVDDKINHAAIERGVPIGSITGRFTKAYREDMAKLGIAQPDIEPFATQHID
QIIRMIEILITGGHAYVAEGHVLFDVSSYPNYGALSGRDIDELIAGARVEVAPYKKNPTD
FVLWKPSTPELPGWDSPWGRGRPGWHIECSAMSAAHLGETIDIHAGGVDLQFPHHENEIA
QSTCAHGGKVFARWWLHNGMLTFDGRKMSKSLGNVLHVHELLKMHPPEALRLLLLRGHYR
QPLDWSDAAIAQSISTLDGWYRVLRELSAIELDPAQPLPVPAQLEETLSDDLNTPKALAE
LSLLADAARQAPSAATKAALLGAGTMLGLLQDDVEVWFKQAGGQNVDAEHVESLLEARHA
ARAAKDFARADAIRNELMAMGVMIEDGAQGTRWSIVKH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgccgatctcgctctataacagcctcagccgccgcatcgagccctttgcgccgctcgat
ccgaatcgggtgacggtgtacctatgcggaccgacggtctacagctatgtgcatatcggc
aatgcgcgcggcccggtcgtcttcgacgtactagtcaaactgctgcgccgccattacccg
caggtgatctacgcccgcaacatcaccgacgtggacgacaagatcaaccacgccgcgatc
gaacgaggggtgccgatcggcagcatcacgggacgcttcaccaaggcgtatcgcgaagac
atggccaagctcgggatcgcgcagccagacatcgagccgttcgccacccaacatatcgac
cagatcatccgcatgatcgaaatcctgatcactggcggacatgcctacgtggcggaaggc
catgtgctgttcgacgtaagctcttaccctaactatggcgcgctttccggtcgcgacatc
gatgagctgatcgccggtgctcgcgtcgaggtcgctccctacaagaaaaacccgaccgac
ttcgtgctgtggaaaccctccacccccgaactgcccggctgggacagcccctggggacgt
ggtcgcccaggttggcatatcgaatgctcggccatgagcgcagcgcacctgggcgagacc
atcgacatccacgccggtggcgtggacctgcagtttccgcatcacgagaacgagatcgcc
cagtccacctgcgcccatggcggcaaggtgtttgcgcgctggtggctgcataacggcatg
ctcaccttcgatggccgcaagatgtccaagtcgctgggcaatgtgctgcacgtgcatgag
ctgctcaagatgcatccaccggaagccctgcgcctgctgttgctgcgtggccactatcgc
cagccgctggattggtccgatgcggccattgcccaatcaatcagtacactggatggctgg
tatcgcgtgctgcgcgaactcagtgcgattgaactcgatcctgctcaaccgctgcccgtg
cccgcccagctcgaagaaaccctgagcgacgacctcaacacccccaaggccctggctgag
ctgtcgttgctggccgatgccgcccgccaagcaccttccgctgccaccaaggccgccctg
ctcggagcgggtacgatgttgggcctgctgcaggacgatgtcgaagtttggttcaaacag
gctggcggccagaacgtggatgccgaacacgtggagagtctgctggaagcacgccacgcc
gcgcgtgccgccaaggattttgcccgtgccgatgctatccgcaacgagctgatggccatg
ggcgtgatgatcgaggacggggcccaaggcacgcgctggagcatcgtaaagcactga

DBGET integrated database retrieval system