KEGG   Dyella sp. M7H15-1: EO087_06375Help
Entry
EO087_06375       CDS       T05846                                 

Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00030  Pentose phosphate pathway
dye00040  Pentose and glucuronate interconversions
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01200  Carbon metabolism
dye01230  Biosynthesis of amino acids
Module
dye_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
dye_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EO087_06375
   00040 Pentose and glucuronate interconversions
    EO087_06375
Enzymes [BR:dye01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     EO087_06375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C
Motif
Other DBs
NCBI-ProteinID: QAU23656
UniProt: A0A410UHJ7
Position
complement(1340134..1340826)
Genome map
AA seq 230 aa AA seqDB search
MSKQSPVIAPSILSADFARLGEDTAKVLAAGGDWVHYDVMDNHYVPNLTMGPMVLKALRD
YGITAPIDVHLMVKPVDRIVPDFAKAGATRISFHPEATEHVDRTLALIKDSGCEAGLVFN
PATPLNWLDHVLDKLDLVLIMSVNPGFGGQTFIHEALNKLRAVRQRIDQSGLPIRLEVDG
GVTADNIGEIAAAGADTFVAGSAIFGAANYQAVIHKMRAALDGDTYSALP
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaatcccctgtcatcgccccttccattctttccgccgatttcgcgcgactg
ggcgaggacaccgccaaggtgttggccgccggcggtgactgggtgcactacgatgtgatg
gacaatcattacgtacccaacctcaccatggggcccatggtgctgaaggcattgcgcgat
tacggcattaccgcaccgatcgatgtgcacttgatggtgaaaccagtggatcgcatcgtg
ccggatttcgccaaggccggcgcaacccgcatcagcttccacccagaagccaccgagcac
gtcgaccgcacccttgccctgatcaaggattccggttgcgaagcagggttggtcttcaat
cccgccacgccactgaactggctcgatcacgtactcgacaagcttgatttggtgctgatc
atgtcggtgaacccgggcttcggcgggcagacattcatccacgaagcgctcaacaaactg
cgcgcggtacgccagcgcatcgatcaaagcggtctaccgatccgcctcgaagtggatggc
ggtgtcacggccgacaacatcggtgagatcgcggcagcaggcgccgacaccttcgtggcc
ggatcggccatcttcggcgcagccaattaccaggccgtgatccacaagatgcgtgctgcc
ctcgacggcgatacttattcagcgttgccttaa

DBGET integrated database retrieval system