KEGG   Dyella sp. M7H15-1: EO087_06405Help
Entry
EO087_06405       CDS       T05846                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00030  Pentose phosphate pathway
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01200  Carbon metabolism
dye01230  Biosynthesis of amino acids
Module
dye_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
dye_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EO087_06405 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    EO087_06405 (tkt)
Enzymes [BR:dye01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     EO087_06405 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh
Motif
Other DBs
NCBI-ProteinID: QAU23661
UniProt: A0A410UHH2
Position
complement(1344108..1346102)
Genome map
AA seq 664 aa AA seqDB search
MTSRRELANAVRALAMDAVEAANSGHPGMPMGMADIAEVLWNDFLKFNPGNPRWPNRDRF
VLSNGHGSMLQYALLHLTGYDLPMAELKRFRQLHSKTAGHPEASETPGVETTTGPLGQGL
ANSVGFALAEKVLAAHFNRPGHAIVDHHTYVFLGDGCLMEGVSHEVASLAGTWKLGKLIA
IYDDNNISIDGEVEGWFTDDTAKRFEAYGWNVIGVVDGHNADAVKRALEQATSQSEKPTL
IICKTIIGFGAPNKQGKEESHGAALGKAEVAAARDMLDWRYAPFEIPTDIYAGWDKKVVG
AEREQQWNDVFAKYKAEHPELAAEFSRRIAGELPADWAEKSQAYIEKMQTEGPDVASRKA
SQMTLDAFGPLLPELVGGSADLAGSNLTMWKGSKNITGPDGNYVHYGVREFGMSAIANGF
ALHGGFLPYDGTFLVFSDYARNAVRMSCLIPAHVIHVYTHDSIGLGEDGPTHQPIEHLGS
LRLIPNNRVWRPCDVVESVVSWKAAIERKNNPSCLIFSRQTLKHQQRTPRQVSDILRGAY
VLSDPADTQFKAILIATGSEVELAMEAARTLAQQNVPVRVVSMPCTEAFDAQPLEYREGV
LPGWCRARVAVEAASVDYWFKYVGLDGEVVGMTTFGGSAPAPALFEHFGFTVGHVVDAVK
RVIG
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccgtcgcgaactcgccaacgccgtccgcgccctggccatggatgctgtggag
gcagccaattccggccaccccggcatgccgatgggcatggccgacatcgccgaagtgctg
tggaacgacttcctgaagttcaaccccggcaacccgaggtggcccaatcgcgaccgtttt
gtgctgtccaacggccacggttcgatgctgcagtacgccctgttgcatctcaccggctac
gacctgcccatggctgagctcaagcgtttccgccagcttcattccaagaccgccggccat
ccggaagccagcgaaaccccaggcgtggaaaccaccaccggaccgctaggccagggcttg
gccaattcggtcggttttgcgctggcagaaaaagtcctggcggcgcatttcaaccgcccg
ggccacgccatcgtcgatcaccacacctacgtattcctgggcgatggctgcctgatggaa
ggcgtttcgcacgaagtcgcctcgctggcaggtacctggaagctgggcaaactgatcgcc
atctacgacgacaacaacatttccatcgacggtgaagtggaaggctggttcaccgacgat
accgccaagcgtttcgaagcctacggttggaatgtcatcggcgtggtggatggccacaac
gctgacgcggtgaagagggcgctggagcaagcgacttcgcagagcgaaaaacccacgttg
atcatttgcaagaccatcatcggcttcggtgccccgaacaagcagggcaaggaagaaagc
catggcgccgcgcttggcaaggccgaagtggccgctgcccgcgacatgctcgactggcgc
tatgcgccgttcgaaattcctaccgacatctacgctggttgggacaaaaaagtcgtcggc
gcagagcgcgaacagcagtggaacgatgtctttgcgaaatacaaagcggagcatccggaa
ctcgctgcggaattcagccgccgcatcgctggtgaactgccggccgattgggcggaaaag
tcgcaggcgtatatcgaaaaaatgcagaccgaaggtccggacgtggcttcgcgcaaggct
tcgcagatgacactggatgccttcggtccgctgctgccggagctggtcggcggttcggca
gacctggcaggttccaacctcaccatgtggaagggcagcaaaaacatcactggccctgat
ggtaattacgttcattacggcgtgcgcgagttcggcatgagtgcgattgccaatggtttc
gcattgcacggcggcttcctgccgtacgacggcacctttctggtgttctccgattacgcc
cgcaacgctgtgcgcatgagctgcctgattccggcacatgttattcacgtctacacgcac
gattcgatcggtttgggcgaggatggtccgacccaccagccgatcgaacacctcggctcg
ttgcgtctgatcccgaacaaccgcgtgtggcgtccgtgcgacgtggtggaatcggtggtg
tcctggaaggccgcgatcgagcgcaagaataatccatcctgcctgatcttctcgcgccag
acgctcaagcatcagcagcgtacgccgcggcaggtatccgacatcttgcgtggtgcgtac
gtgctttccgatccggccgatacccagttcaaggcgatcctgatcgctacaggttccgaa
gtggaattggcgatggaagcggcccgcacgctggcacagcagaacgtgccggtgcgcgtg
gtgtcgatgccgtgcacggaagcgttcgatgcccaaccgctggaataccgcgaaggcgtg
ctgccaggctggtgtcgtgcacgcgtggcggtggaagccgctagcgtggactactggttc
aagtacgttggcctagatggtgaagtggttggcatgaccacctttggcggatctgcgccg
gcgccggccttgttcgagcactttggtttcaccgttggccacgtggtggatgcggtgaag
cgcgtcatcggttga

DBGET integrated database retrieval system