KEGG   Dyella sp. M7H15-1: EO087_06890Help
Entry
EO087_06890       CDS       T05846                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00260  Glycine, serine and threonine metabolism
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EO087_06890
Enzymes [BR:dye01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     EO087_06890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: QAU23740
UniProt: A0A410UHI2
Position
complement(1441966..1442982)
Genome map
AA seq 338 aa AA seqDB search
MDWVDLHSDTVTRPTRAMRAAMLDAEVGDDVYGEDPAVNALQQRLAGDLGFEAGLFVPSG
TQSNLLALMTHCERGDEYIVGADAHTYKFEGGGAAVLGSIQPQPIAHDVDGSLPLDKVAV
AIKPIDPHFARTRLLALENTWHGRIMSMDYIRAARDFTKERGLALHLDGARLYNAAVASG
VRPREITQHFDSVSICLSKGLGAPVGSVLVGSVALVDKARRWRKVAGGGWRQAGMLAAAC
MHALDHHVERLADDHARAARLAEGLSDIPGVKLLGLHTNMVFIDVPAECLRGLDAHLRAA
SVRIGIGYLPTLRLVTHLDIDDAGVERVIDAFRLFFAG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtggattgggttgatttacacagcgacacggtaaccaggccgactcgcgccatgcgagcg
gcgatgctggatgccgaggtgggcgatgacgtctatggcgaagatcccgccgttaacgcg
cttcagcaacgccttgccggagatcttggctttgaagcgggtttattcgtgccatccggt
acgcaatcgaacctgctggccctgatgacgcactgcgagcgcggcgatgagtacatcgtt
ggcgcggatgcgcatacgtacaagttcgaaggtggtggtgcggcggtgttaggttcgatc
cagccgcagccgatagcgcatgatgtggatggctcgctgccattggacaaagtggcggtc
gccatcaagccgattgatccgcactttgcacgtactcgcctgctggcgctggaaaacacc
tggcacgggcgcatcatgtcgatggactacatccgggccgcgcgtgatttcaccaaggaa
cgtgggcttgcgttgcatctggatggtgcgcggctttataacgccgctgtggcgagcggt
gtgaggccgagggagattacccaacacttcgacagtgtttccatctgcttgtcgaagggt
ttgggtgccccagttggttcggtattggtgggctccgtcgcgctggtcgacaaggcgcgt
cgctggcgcaaggtcgctggcggcggttggcgtcaggccggcatgctggccgctgcgtgc
atgcatgcgctggatcatcatgttgagcgtctggccgatgaccacgcacgtgcggcgcgc
ctggcggagggtttgagtgatattcccggtgtgaagctgcttggcctgcacaccaacatg
gtgttcatcgatgtgccagcggaatgcttgcgtggattggatgcgcatctgcgtgcagcg
tcggtgcgtatcggtattggctatctgccgacgctgcggttggtgacgcatctggatatc
gatgatgcgggtgttgaaagggtgatcgatgcattccgactattctttgccggctaa

DBGET integrated database retrieval system