KEGG   Dyella sp. M7H15-1: EO087_07090Help
Entry
EO087_07090       CDS       T05846                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00620  Pyruvate metabolism
dye00630  Glyoxylate and dicarboxylate metabolism
dye01100  Metabolic pathways
dye01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EO087_07090 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    EO087_07090 (aldA)
Enzymes [BR:dye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     EO087_07090 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     EO087_07090 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: QAU23776
UniProt: A0A410UHX3
Position
complement(1491697..1493121)
Genome map
AA seq 474 aa AA seqDB search
MHNERNFMDGVFVDAGGEPPIAVHNPATGEHIAEIDAASPAQVQVAVAVAARAQRDWARR
PAIERAQYLRKLADVLVANAARIGAALASESGKSLTDASNEAIYAAEITRYHAEWARRIE
GEVIPSDSADETILLQREPIGVVACLIPFNYPVYTLLRKVAPALITGNTVVVRPSNNTPL
CAFEIARAVEQAGFPAGVVNILAMRHEHASLLCTQPPVGMITLTGSVGVGRSVLEYCKVN
IAKPSLELGGKTPAIIEPDADLEQAASAIVASKTTNCGQLCTAIERVYVHARVHDRFLNL
LREKFAAIRIGDRSEDPSRMGPLISEGARRDIHAKVMRAAAEGAVLEAGGAIPEGRGFFY
PATLLSHCRQDMEIVQEEIFGPVLPVLCYGTLDEALRMANDHQFGLSSVLYTEQYRTALK
VANRIEAGELYVNRTPADPYQGFHAGWKRSGLGGDDGKHGMLEFTQTRLVVMRY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacgagcggaactttatggatggcgtattcgtcgatgcgggtggcgagccgccg
attgccgtgcataaccctgcgactggtgaacacatcgccgagatcgacgcagctagcccg
gcacaggtgcaagttgccgttgccgttgcagcacgggcgcagcgcgattgggcgcgccgg
ccggccatcgaacgcgcgcaatacctgcgcaaactggcggatgtgctcgtggccaatgcg
gcacggatcggtgccgcattggccagcgaatccggcaaaagcttgactgacgccagcaac
gaagccatctatgccgcagaaattacgcgctatcacgccgaatgggctcgccgcatcgag
ggcgaagtgattccgagcgacagcgccgatgaaactatcctgttgcagcgtgagccgatt
ggcgtcgtagcctgcctgattcctttcaactatccggtttataccttgctgcgcaaggtg
gcgccggccttgattaccggcaataccgtggtggtcaggcccagcaacaacacgccgcta
tgcgcctttgaaattgcccgtgcggttgaacaggcgggattccccgccggtgtcgtgaac
atcctggcgatgcgacacgagcatgccagcctactctgcacccagcctccggtcggcatg
atcacgcttaccggcagcgttggcgtcggtcgttcggtactggaatattgcaaggtgaat
atcgccaagccatcgctggaacttggcggcaagactccggcgatcatcgagccggatgcg
gatctggaacaagcggccagcgcgattgtggcgtccaagaccacgaactgcggtcagttg
tgtaccgccatcgaacgcgtctacgtgcacgccagggtgcatgaccgctttctgaacttg
ttgcgcgagaagttcgccgccattcgcatcggcgatcgctccgaagatccttcccgcatg
gggccgctgatcagcgagggcgcgcgccgggacattcatgccaaggtgatgcgcgccgcg
gctgaaggtgccgtactcgaagcgggtggtgccatacccgaaggccgtggcttcttctat
ccggccaccttactgagtcattgccggcaggacatggagatcgtgcaagaagaaatcttc
gggccagtgctgccggtgctttgctatggcacgctggacgaagcgctgcggatggccaat
gatcaccagttcggcctgtcttccgtgctctataccgagcaatatcgcacggcgctcaag
gttgccaatcgcatcgaagcgggcgagctctacgtcaatcgcacaccggccgatccttat
caaggcttccatgcaggctggaagcgttccggcctgggcggtgacgacggcaagcacggc
atgctggagttcacccagacacgtctcgtggtcatgaggtactaa

DBGET integrated database retrieval system