KEGG   Dyella sp. M7H15-1: EO087_07360Help
Entry
EO087_07360       CDS       T05846                                 

Gene name
cysK
Definition
(GenBank) cysteine synthase A
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00270  Cysteine and methionine metabolism
dye00920  Sulfur metabolism
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01200  Carbon metabolism
dye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    EO087_07360 (cysK)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EO087_07360 (cysK)
Enzymes [BR:dye01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     EO087_07360 (cysK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: QAU23826
UniProt: A0A410UI22
Position
1564620..1565576
Genome map
AA seq 318 aa AA seqDB search
MIYENILDTIGNTPIVRLHRVAPAHVTLYTKIEAFNPGGSVKDRLAIAVILDAERKGLLK
PGDTVVEATSGNTGIALAMVCAARGYKFVATMSETFSVERRKLMRAYGAKVIVTPATERG
SGMVQRAEALAAKHGWFLPRQFQNPANPAYHRNTTAAEILRDFAGKRLDAFVTGWGTGGT
LTGVGEVLKVARPEVKIVVSEPAGASLLGDQPWQPHKIQGWTPDFVPEVLNRQIFDIDLP
VDDVLARDTSRRLAKEEGIFVGISAGATVAAALKYAETAEKGSVILAMLPDTGERYLSTF
LFEGVDEGSDDGWLESLG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgagaacattctagacaccatcggcaatacgcccatcgtccgcctgcatcgc
gtggcaccggcccacgtcacgttgtataccaagatagaagcgttcaatcccggcggttcg
gtcaaggatcgtctcgccattgcggtgatcctcgacgcggaaaggaagggtctgttgaag
cccggcgacacggtcgtcgaagcgacttccggcaataccggcatcgcgctggcgatggtc
tgcgccgcacgcggctacaagttcgtggcaaccatgagcgaaaccttctcggtggaacgg
cgcaaattgatgcgcgcctatggcgccaaggtgattgtcacgcctgctactgagcgcggc
agcggcatggtccagcgtgcggaagcactggcggctaaacacggctggttcctgcctcgg
cagttccagaacccggccaatccggcttatcaccgcaacaccacggcggcggagatcctg
cgtgatttcgccggcaagcgactcgacgccttcgtgaccggctggggcaccggcggcacg
ctaacgggtgtgggcgaagtactcaaagtcgcccgccccgaagtgaagatcgtggtttcc
gaacctgccggcgcatcgctgcttggcgatcagccgtggcagccacacaagatccagggc
tggacaccggacttcgtgccggaagtgctcaaccgccaaatcttcgatatcgatctgcca
gtggatgacgtgctggctcgtgacacatcgcgccgcctggcgaaagaagaaggcattttt
gtcggcatttccgccggtgcaaccgtggccgccgcactgaagtatgcggaaacggccgag
aaaggcagcgtgatcctggcgatgttgcccgataccggcgaacgctatctgtccaccttt
ctgtttgaaggcgtggatgaaggatcggatgatgggtggttggagagtctgggctaa

DBGET integrated database retrieval system