KEGG   Dyella sp. M7H15-1: EO087_07440Help
Entry
EO087_07440       CDS       T05846                                 

Definition
(GenBank) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00260  Glycine, serine and threonine metabolism
dye00460  Cyanoamino acid metabolism
dye00630  Glyoxylate and dicarboxylate metabolism
dye00670  One carbon pool by folate
dye00680  Methane metabolism
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01200  Carbon metabolism
dye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EO087_07440
  09102 Energy metabolism
   00680 Methane metabolism
    EO087_07440
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EO087_07440
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    EO087_07440
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EO087_07440
Enzymes [BR:dye01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     EO087_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: QAU23840
UniProt: A0A410UHT0
Position
complement(1580005..1581258)
Genome map
AA seq 417 aa AA seqDB search
MFPKIDTIVGYDNELAKAIADEARRQETHVELIASENYASPRVLEAQGSVLTNKYAEGYP
GKRYYGGCEYVDVAERLAIERLKQLFGATYANVQPHSGSQANQAVYFALLNPGDTILGMS
LAHGGHLTHGAKVNISGKLLNAVQYGVNEHGLVDYDEVERLAVEHKPKMIVAGFSAYSQV
MDWARFRTIADKVGAYLFVDMAHVAGLIAAGVYPNPVPHAHVVTSTTHKTLRGPRGGFVI
AKDAGEEIEKKLQSIVFPGIQGGPLMHVIAAKAVAFKEALEPAFKDYQAQVVKNAKAMAK
TFIERGYKIVSGGTENHLMLVDLIGRDVTGKDAEEALGRAHITVNKNAVPNDPRKPFVTS
GLRVGTPAVTTRGYKESDVVELTHWICDVLDAPADEGVIKAAREKVSAQCKTFPVYG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttcccgaagatcgacacgatcgtcggctatgacaatgaactagccaaggccattgcc
gacgaagcgcgacgccaggagacccacgtcgagctgatcgcttccgagaactacgccagc
ccgcgcgtgctggaagcccaagggtccgtgctcaccaataaatacgccgagggttatccc
ggcaaacgctattacggtggctgcgaatacgtggacgtggccgaacgcctcgccatcgag
cgcctcaagcaactgttcggcgccacctacgccaacgtgcagccgcattccggctcgcaa
gccaaccaggcggtgtacttcgcgctgctcaatccgggcgacaccattctgggcatgagc
ctggcccacggtggccatctcacgcacggtgccaaggtcaacatctccggcaagctgctc
aacgcggtgcagtacggcgtcaacgagcacggcctggtcgattacgacgaagtcgagcgc
ctggctgtcgagcacaagccgaagatgatcgtggccggcttcagcgcttattcgcaggtg
atggactgggcgcgctttcgcaccatcgccgacaaggtcggtgcctacctgttcgtcgat
atggcgcacgtggccggcttgatcgccgcgggggtgtatccgaaccccgtaccgcatgca
cacgtggttacttccaccacgcataagaccctgcgcggtccgcgcggtggtttcgtgatc
gccaaggacgcgggtgaagagatagagaagaagctgcaatcgatcgtgttccccggtatc
cagggcggcccgctgatgcacgtcatcgccgccaaggcggtagccttcaaggaagcgttg
gagccggcattcaaggactaccaggcgcaagtggtgaaaaacgccaaggcgatggccaag
acctttatcgagcgcggttacaaaatcgtgtccggtggcaccgagaaccatctgatgctg
gtcgacctgatcggtcgcgatgtcactggcaaggacgcggaagaggcactgggccgagcg
cacatcacggtcaacaagaacgctgtgccaaacgatccacgcaaaccttttgtcacctcc
ggcctgcgcgtgggtacccccgccgtcaccactcgcggctacaaggaatccgatgtagtc
gagctgacccattggatctgcgacgtgctagatgcgccggccgatgaaggtgtgatcaaa
gccgcgcgcgaaaaagtatcggctcaatgcaagacattccctgtttatggttaa

DBGET integrated database retrieval system