KEGG   Dyella sp. M7H15-1: EO087_09395Help
Entry
EO087_09395       CDS       T05846                                 

Gene name
aroQ
Definition
(GenBank) type II 3-dehydroquinate dehydratase
  KO
K03786  3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
dye01230  Biosynthesis of amino acids
Module
dye_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EO087_09395 (aroQ)
Enzymes [BR:dye01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     EO087_09395 (aroQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHquinase_II
Motif
Other DBs
NCBI-ProteinID: QAU24176
UniProt: A0A410UJ18
Position
2010525..2010995
Genome map
AA seq 156 aa AA seqDB search
MAKLLVLHGPNLNLLGVREPEIYGRDTLADINHRLAQHAQAAGHALDWYQSNAEHELIGR
IHQARDEQISYILINPGAFTHTSVALRDALAAVAIPFIELHMSNVHAREPFRRHSYLSDL
AMGVICGFGSDSYRLALDITLTKLEAKQAGQFTRTP
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagctgctggtcctgcacggacccaatctcaacttgcttggcgtgcgcgaaccg
gagatctacggccgggacacactcgctgatatcaaccatcggctggcgcaacacgcacaa
gcggctgggcacgcgctggactggtaccagtccaatgccgagcatgagctgatcgggcgc
atccatcaggctcgcgacgaacagatttcctacatcctgatcaatccgggtgcctttacc
cacaccagcgttgccctgcgcgatgccctggccgcggtagccattccatttatcgagcta
cacatgagcaacgtgcacgcccgcgagccgttccgccgccactcctacctgtccgacctg
gcgatgggtgtgatctgcggctttggcagcgacagctatcgcctggcactagatatcacc
ctgaccaagcttgaagcaaagcaggccggccagttcacccgcaccccttaa

DBGET integrated database retrieval system