KEGG   Dyella sp. M7H15-1: EO087_10510Help
Entry
EO087_10510       CDS       T05846                                 

Gene name
rpiA
Definition
(GenBank) ribose-5-phosphate isomerase RpiA
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00030  Pentose phosphate pathway
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01200  Carbon metabolism
dye01230  Biosynthesis of amino acids
Module
dye_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
dye_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EO087_10510 (rpiA)
Enzymes [BR:dye01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     EO087_10510 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: QAU24369
UniProt: A0A410UJ92
Position
2256803..2257441
Genome map
AA seq 212 aa AA seqDB search
MSSEEKRIAGETAIPYVEDGAIVGVGTGSTVAFFIDALADIKDRIQGVVSSSEQSTAQLK
RHGIPVFDLNATGPLALYVDGADECDPYRHLIKGGGAALTREKIVAEAAQKFVCIIDSSK
RVDLLGKFPLPIEVIPMARSLVGREIVKRGGNPVWRDGVVTDNGNWIIDVHGWRIADPVA
LENDLNQIPGIVTVGLFARRPADVVLIGDKVM
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgaagaaaagcgcatcgcgggcgaaaccgctatcccgtatgtggaagacggc
gcgatagtcggcgtgggtaccggttcgaccgtcgccttctttattgatgcactggccgat
atcaaggatcgtatccagggggtggtgtccagctcggaacagtcgacggctcagttgaag
aggcacggcatccccgtgttcgacctcaacgccactggcccgctcgcgctttatgtagat
ggcgccgatgaatgcgatccatacaggcacctgatcaagggcggcggcgctgcgcttacc
cgcgagaagatcgttgccgaagccgcacaaaagttcgtctgcatcatcgactccagtaag
cgcgtcgacctgctgggcaaattcccactgccgatcgaagtgattccgatggcgcgcagc
ctggtcggccgcgagatcgtgaagcgtggcggcaatccggtgtggcgcgacggcgtggtc
accgacaacggcaactggatcatcgatgtgcacggctggcgaattgccgatccagtggcg
ctggagaatgatctgaatcagattcccgggatcgttacggtgggattgttcgcacggcgc
ccggcagacgtggtgctaattggcgacaaggtaatgtaa

DBGET integrated database retrieval system