KEGG   Dyella sp. M7H15-1: EO087_10915Help
Entry
EO087_10915       CDS       T05846                                 

Definition
(GenBank) 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00010  Glycolysis / Gluconeogenesis
dye00260  Glycine, serine and threonine metabolism
dye00680  Methane metabolism
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01200  Carbon metabolism
dye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EO087_10915
  09102 Energy metabolism
   00680 Methane metabolism
    EO087_10915
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EO087_10915
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dye04131]
    EO087_10915
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dye04147]
    EO087_10915
Enzymes [BR:dye01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EO087_10915
Membrane trafficking [BR:dye04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EO087_10915
Exosome [BR:dye04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EO087_10915
  Exosomal proteins of melanoma cells
   EO087_10915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: QAU24440
UniProt: A0A410UJJ4
Position
complement(2351107..2351850)
Genome map
AA seq 247 aa AA seqDB search
MHKLVLIRHGQSQWNLENRFSGWADVDITEQGAAEACEAGELLVQDGYQFDVAHTSVLKR
AVRTLWHVQDAMDLMWIPVVTEWRLNERHYGALTGLNKAETAAKYGEDQVKVWRRSYDIP
PPALGCDANPSLRDPRYAELDPKLIPDTECLKDTVARVMPYWNEVLAPVISAGQRVLLVA
HGNSIRALVKYLDGISDEDIVELNIPNGVPLVYEFDDKLKPLRHYYLGDAAAIAAKMAAV
ANQGKAK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagctcgtattgatccgtcacggccaatcccagtggaacctcgaaaaccgcttc
agcggctgggccgacgtcgatatcactgaacagggggcggcagaggcctgtgaggctggt
gagctgttggtccaggatggctatcagttcgatgtggcgcatacctcggtgctcaagcgc
gccgtacgcactctgtggcatgtgcaggatgcgatggatctgatgtggattccggtggtg
accgagtggcgtctcaacgagcgtcattacggcgccctgaccggtctcaacaaggccgaa
acggctgcgaaatacggcgaggatcaggtgaaggtctggcgccgcagctatgacattcct
ccgccggcattggggtgtgatgcaaacccttcattgcgcgatccgcgctacgccgaactc
gatcccaagctgattccggataccgaatgcctaaaagatacggtggcccgcgtcatgccg
tactggaatgaggtgctagcaccggtaatcagcgctggtcagcgcgtactgctggtcgcg
cacggcaattcgatccgcgcactggtgaaataccttgatggtatttctgatgaggacatc
gtcgagctcaacattcctaacggtgtaccactggtttacgaattcgacgataagctcaag
ccgctgcgccattattatctgggtgatgccgctgccattgcagcgaaaatggctgcggtg
gccaatcagggtaaggccaagtaa

DBGET integrated database retrieval system