KEGG   Dyella sp. M7H15-1: EO087_11265Help
Entry
EO087_11265       CDS       T05846                                 

Gene name
tal
Definition
(GenBank) transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00030  Pentose phosphate pathway
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01200  Carbon metabolism
dye01230  Biosynthesis of amino acids
Module
dye_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
dye_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EO087_11265 (tal)
Enzymes [BR:dye01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     EO087_11265 (tal)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-ProteinID: QAU24495
UniProt: A0A410UJR2
Position
2429522..2430595
Genome map
AA seq 357 aa AA seqDB search
MEHPTRTLNGLGQSLWLDNITRSMLGDGTLLGYREQKSVTGLTSNPTIFAQAIKSGKDYD
ASIRAAGQVEPETIFFGLAIDDLRRAAAIFEPVYQHTHGVDGWVSLEVSPLLADDTARTV
EQSVALHKQAAVHNLFIKVPGTPAGIGAIEELIFRGVPINVTLLFSPVQYQAAADAWLRG
LERRHAAGLDLDVASVASIFISRWDVKVADKVSAELQNKLGFAVCGQIYAKYRQLLDSPR
LQRLQNAGARVQRLLWASTGTKDPQASDVLYIENLVAPLTVNTMPQKTLLAFADHGKAAH
LMALNDPSVASTLAKFEAAGILVEPLAKTLQQEGADTFVKSWRELLDTISERMGATA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaacacccaacccgcacgctcaatggactcggccagagcctttggctggataacatc
acgcgaagcatgttgggcgacggtaccttactaggctaccgcgagcaaaagagtgttacc
ggcctgacctccaaccccaccatctttgcccaggccatcaagtccggtaaggactatgac
gcgtcgatccgcgctgccgggcaggtggagccggaaacgattttcttcggcttggccatc
gacgaccttcgtcgcgccgccgccatcttcgagccggtctatcagcatacgcatggcgtg
gacggatgggtgtcgctggaagtttcgccgttgctggcggacgacaccgcccgcaccgtc
gagcagtcggttgcactgcacaagcaggccgcggtgcacaaccttttcatcaaggtgccg
ggcacgccggccggcatcggcgccatcgaagaactgatcttccgcggcgtgccgatcaat
gtgaccctcctgttctcgcccgtgcaataccaggcggcggccgatgcctggctgcgcggc
cttgaacgtcgtcatgcggcaggattggatctggacgtggcttcggtcgcgtcgatattc
atcagtcgctgggatgtgaaagtggccgacaaggtatcggctgagctgcagaataaactc
ggctttgcggtatgcggacagatttacgctaagtaccgccagctacttgattcgccacgc
ctgcagcgcctgcagaacgccggggcgcgcgtacagcgcctgctctgggccagcacgggc
accaaggatccgcaagccagcgatgtgctttacattgaaaacctggtagcgccgctgacc
gtcaacaccatgccgcaaaagaccctgttggccttcgccgatcatggcaaggctgcgcat
ctgatggccctgaacgacccgagcgtggccagcacgctggcgaagttcgaggctgctggc
atcctggtcgagccgctggcgaagacacttcagcaggaaggtgccgatacattcgtgaag
tcctggcgcgaattgctggataccatcagcgagcgcatgggagccaccgcatga

DBGET integrated database retrieval system