KEGG   Dyella sp. M7H15-1: EO087_13800Help
Entry
EO087_13800       CDS       T05846                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00051  Fructose and mannose metabolism
dye00520  Amino sugar and nucleotide sugar metabolism
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EO087_13800
   00520 Amino sugar and nucleotide sugar metabolism
    EO087_13800
Enzymes [BR:dye01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     EO087_13800
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     EO087_13800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding CENP-C_C
Motif
Other DBs
NCBI-ProteinID: QAU24930
UniProt: A0A410UL04
Position
complement(3005075..3006487)
Genome map
AA seq 470 aa AA seqDB search
MLIPLILSGGSGTRLWPVSRRNLPKQFLSLSGNGTLFQQAVIRTQKLPEVAAPIVVASED
HRFLVADQLLEEGIQGATIVLEPLARNTAPAIALGALKALERNPEALLLVLPADHLIGDT
RSFNAAVQQALPAAREGWLATFGIRPDRPETGFGYICRAEPVGGNAFRVERFVEKPDLAT
AESYVKHGGYDWNSGMFLFKATRYLEELGQHAPEMLEAVRKAYATGHGDLDFVRVDAEAF
AKVPDNSIDYAVMEKTSRAAVIPVSCAWSDIGSWSALWLSGKHDEHGNQREGDTLAINTR
NSLLRSHDRHMIATVGVDDLIVVSTPDATLVAHRNAAQDVKKVVDRLKASGRTEHSFHRV
VHRPWGSYDSLEAGGRFQVKRIVVKPGASLSLQKHHHRAEHWIVVSGTAEVTCDDKVFLM
AENQSTYIPLGSMHRLRNPGKVPLELIEVQSGSYLGEDDIVRFDDVYGRA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgttgattcctcttattctcagcggcggcagcggcacccgcctgtggcctgtttcgcgc
cggaacctcccgaagcaatttctctccctgagcgggaatggcacgctgttccaacaagct
gttatccgtacgcagaagctgccggaagtcgcggcacccatcgtggtggctagcgaagat
caccgcttcctcgtggccgaccagttgctcgaagagggtatacaaggcgccaccatcgtg
cttgaaccgcttgcacgtaatacggccccagctattgcattgggtgccttgaaggcgttg
gaacgcaatccggaagccttgcttctcgtactcccggcggaccatctgatcggtgacacc
cgcagcttcaatgcagccgtgcagcaggccctgcctgccgcacgcgaaggctggctcgct
acattcggtattcgccccgaccgcccggagacgggttttggttatatctgccgcgccgag
cccgtcggcggtaacgcattccgcgtagaacgtttcgtggaaaagccggatctcgccacc
gccgaaagctatgtcaaacacggcggctatgactggaattcgggcatgttcctgttcaag
gccacacgctatctggaagagttaggccaacatgcgccggagatgctcgaagcagtgcgc
aaggcatatgccaccggacatggcgatctggatttcgtcagagtggatgccgaagccttc
gccaaggtgccagacaattccatcgactatgcagtcatggaaaaaacctcccgcgccgcg
gtgattccggtgagttgcgcgtggagcgatatcggctcatggtcggcgctatggttgtct
ggcaagcacgacgagcacggcaaccagcgcgagggagacaccctggcgatcaacacccgc
aactcgctgctgcgctcgcacgatcgacacatgatcgccacggttggcgtagacgacctg
atcgtggtcagcacaccggacgccaccctggtcgcgcatcgcaatgccgcccaggatgtg
aagaaggtagtcgaccgactgaaggcctcgggccgcaccgagcactccttccaccgtgtg
gtgcatcgtccgtggggcagctacgactcgctcgaagcaggcgggcgtttccaggtgaag
cgcatcgtggtgaaaccaggtgccagcctgagcttgcagaagcaccaccatcgcgccgaa
cactggatcgtagtgtcaggcacggctgaagtcacctgtgacgacaaggtgttcctgatg
gccgagaatcagagcacctacatccctttaggcagcatgcaccgcctgcgcaacccgggc
aaggtgccgctggaacttatcgaggtgcaatccggcagctatttgggcgaagacgatatc
gttcgcttcgacgacgtctacggccgtgcctga

DBGET integrated database retrieval system