KEGG   Dyella sp. M7H15-1: EO087_14175Help
Entry
EO087_14175       CDS       T05846                                 

Gene name
metB
Definition
(GenBank) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00270  Cysteine and methionine metabolism
dye00450  Selenocompound metabolism
dye00920  Sulfur metabolism
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
dye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    EO087_14175 (metB)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EO087_14175 (metB)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EO087_14175 (metB)
Enzymes [BR:dye01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     EO087_14175 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 GDC-P Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: QAU25000
UniProt: A0A410UL69
Position
3098711..3099919
Genome map
AA seq 402 aa AA seqDB search
MCADVVNEPASSTRAVRAGIESDTQHGAVVPPLHLSTNYTFTGLGGKRAYDYSRSGNPTR
DLLGNALADLEQGSGAVITASGMAAVALALELVPAGSTILAAHDCYGGTWRLLDAWAKKG
RFNVCFVDFTDSQALAEGLASKPSLLWVETPSNPLLRITDIRHVAQAAHAVGALVVVDNT
FLSPALQQPLALGADVVVHSTTKYINGHSDVVGGAVVARDAAVAEQLKWWGNCNGLTGAP
FDSYLTLRGLRTLGVRLRQHQENAERIVTLLDRHDAVRKVYYPGLENHAGHALATRQQQG
FGAMLSFELHGDVAHIAAFVDGLHYFSLAESLGGVESLIAHPASMTHAAMTPEARRAAGI
ADTLLRLSVGIEDAEDLLHDLDAALQRAQAVSGDASKRRVTA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgatgtcgtaaacgaacctgcctccagcactcgcgcggtacgcgcaggtatt
gaatcggacacgcagcacggcgcggttgtaccgccgctgcatctttccaccaactacacg
ttcaccgggctaggcggcaagcgtgcgtacgactattcgcgcagcggtaacccgacgcgg
gatttgcttggcaacgctctggccgatttggagcagggaagcggtgccgtgatcactgcc
agtggtatggccgcggtggcgctggctttggagttggtgcccgccggttcgaccattctc
gccgctcacgattgctacggtggcacatggcgcttgttggatgcctgggccaagaagggg
cgcttcaacgtgtgctttgttgatttcactgacagccaggcacttgctgaaggactggcg
agcaagccgtcgttgttatgggtggaaaccccgtccaacccgctgctgcggattaccgat
attcgccatgttgcgcaggcggctcatgcggtcggcgcacttgtggtggtcgacaacact
tttctttcaccggctttgcagcagccgttggcgttaggtgctgatgtcgtggtgcattcc
accaccaagtacatcaatggccacagcgatgtcgtaggtggggctgtcgtggcgcgtgat
gcggccgtggccgaacagctcaaatggtggggtaactgcaatggccttaccggcgcgccg
tttgacagctacctaacgttgcgcggcctgcgcacgctgggtgtgcgtctgcgtcaacac
caggaaaatgccgagcgcatcgttacgctccttgatcgccatgatgcggtgcgcaaggtc
tattatccggggctcgagaaccacgcaggccacgcactcgcgacgcgtcagcagcaaggt
ttcggcgccatgctgagtttcgagctgcatggcgatgtggcacacatcgcagcctttgtg
gacggtctccattatttctcgttggctgaatcgctcggtggcgtggaaagtttgatcgcg
catccggcctccatgacgcacgctgcgatgactccggaagcacgtcgcgctgccggcatc
gccgacacgctgctgcgactttccgtcggtatagaggatgctgaggacctgctgcatgac
ctggacgcagcgctgcagcgcgcacaagccgtttcgggcgatgcatccaaacgacgggtg
actgcatga

DBGET integrated database retrieval system