KEGG   Dyella sp. M7H15-1: EO087_14180Help
Entry
EO087_14180       CDS       T05846                                 

Definition
(GenBank) homoserine dehydrogenase
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00260  Glycine, serine and threonine metabolism
dye00261  Monobactam biosynthesis
dye00270  Cysteine and methionine metabolism
dye00300  Lysine biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01230  Biosynthesis of amino acids
Module
dye_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
dye_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EO087_14180
   00270 Cysteine and methionine metabolism
    EO087_14180
   00300 Lysine biosynthesis
    EO087_14180
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    EO087_14180
Enzymes [BR:dye01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     EO087_14180
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     EO087_14180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh NAD_binding_3 GHL6
Motif
Other DBs
NCBI-ProteinID: QAU25001
UniProt: A0A410UL75
Position
3099916..3101001
Genome map
AA seq 361 aa AA seqDB search
MSAVWVEVPVRKPVPMAKADIAMVLLGTGVVGGAFLKLLRTPVAKRLHLVGAANSRKQQT
DPTQLAARDLRDRLKREGTARDDAALLSALDAHHAELKVIIDATASTELASRHAEWLARD
YHVVTANKSLAGGRLAGWRELQAACAVGGRYGDSATVGAGLPVLSTLRRLGDCGDSLLTL
EGVFSGSLSYLFNQYDGSRPFSALLRDARKLGYTEPDPRADLSGEDVARKLLILARNAGF
ALGSDEVVVESLVPEALRDMSTEAFLDRLEELDESLAALHDSARARGHVLRFLARLNQWG
RARVGLTAVPLNHPAARLYGTDNQFALTTTRYHTQPLVIQGPGAGPEVTAQALLGDVLAL
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggtatgggtcgaggtgccggtacgcaagcctgtgccgatggcaaaagccgat
atcgccatggtgctgcttggtactggggtggtaggcggtgcgttcctgaagctgctacgt
acaccggtcgccaaacgcttgcatctggtgggggcggcgaattcgcgcaagcaacaaacg
gatccaacgcagcttgccgcacgcgatctgcgtgatcggcttaagcgcgaaggcacggcg
cgagatgacgccgcactgctgtccgcgctggatgcgcatcacgccgaattgaaggtcatt
atcgacgcgacggcgtcaacggagctggcgtcacgtcatgcagaatggctggctcgcgat
tatcacgtcgtcaccgccaacaaatcgctggcgggtggccggctcgcaggttggcgcgag
ctacaagctgcgtgtgccgtgggtggtcgttatggcgattccgcgaccgtaggcgcgggg
ctgccggtattgtcgaccctgcgtcgcctgggtgattgcggcgatagcttgcttacgctg
gaaggcgtgttttccggctcgttgtcttatctgttcaatcagtacgacggcagtcgtccg
ttctctgcgctgctgcgcgatgcgcgcaagctgggttataccgaaccggatcctcgtgcg
gatctctccggcgaggatgtcgcgcgcaagctgctgattctggcacgcaacgctggtttc
gcattgggtagtgacgaagtggtggtagaaagcctggtgcccgaagcattgcgcgacatg
tctaccgaagcgtttctggatcgcctggaagagctggacgaatcattggccgcgctgcat
gacagcgctcgcgcaagaggccacgtactgcgttttctcgcacggctcaatcagtggggc
cgcgcacgtgttggtttgacagccgtgccgctcaatcatcctgccgcacgtttgtacggc
acggacaaccagtttgcactgacgaccacgcgttatcacacgcagccactggtgattcag
ggacccggggcagggccggaggtaaccgcccaggccctgctgggtgacgtactcgccctg
ggttag

DBGET integrated database retrieval system