KEGG   Dyella sp. M7H15-1: EO087_14695Help
Entry
EO087_14695       CDS       T05846                                 

Definition
(GenBank) acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00290  Valine, leucine and isoleucine biosynthesis
dye00650  Butanoate metabolism
dye00660  C5-Branched dibasic acid metabolism
dye00770  Pantothenate and CoA biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01130  Biosynthesis of antibiotics
dye01210  2-Oxocarboxylic acid metabolism
dye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EO087_14695
   00660 C5-Branched dibasic acid metabolism
    EO087_14695
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    EO087_14695
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    EO087_14695
Enzymes [BR:dye01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     EO087_14695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M Peptidase_M55
Motif
Other DBs
NCBI-ProteinID: QAU25082
UniProt: A0A410ULE3
Position
complement(3204054..3205697)
Genome map
AA seq 547 aa AA seqDB search
MKAATLFVKALEAEGVDRIFGIPGEENLDLVEAMRESSIRLIVTRHEQAAGFMAATWGRL
TGQAGVALSTLGPGATNLVTAAAYAQLGAMPMLMITGQKPIRMHKQGLFQLVDVVDMMQP
LTKFTRQIVSAATIPARIREAFRRAEEERPGAVHLEFPEDIARDDIEDAILLPTEYARRP
SPDDAALVQAAEAISSAKHPILMMGAAANRQRTAVALRAFIDKLGIPFFTTQMGKGVVDE
DHPLWLGNAALSDGDFVHRAIDAADVIINAGHDVVEKPPFFMQRGRRTVIHINFSSAEVD
AVYFPQIEVVGDIAHTIERLTDALVKQEQWDFSYFDKVRHAFQEQLQQYTHEARFPMHPV
RIVSDTRKYMPDDGILCLDNGMYKLWYARYYKARQPNTVLLDNALATMGAGLPSAMAAKM
VYPERKVLAICGDGGFMMNAQELETAVRLKMDLVILLVRDDAYGMIRWKQADMGFADFGM
QFSNPDFVAFAEAHGAHGHRPERADEFLPALQRAFDEGGVHLIDLAIDYSDNHRVLDEEI
RRLSAAV
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcgactttattcgtgaaagcactggaagccgaaggggtagaccgcattttc
ggcatacctggcgaagagaacctggatctggtcgaagccatgcgggaatcctcgatccgc
ttgatcgtgacccgacatgagcaggccgccgggttcatggcggctacctggggacggctc
accggacaggccggcgtggcgctttccaccctgggccctggggcgaccaacctggtcacc
gccgcggcttacgcccagctcggcgcgatgccaatgctgatgatcaccggccaaaagccg
atccgcatgcacaagcagggcctgttccaactggtggacgtggtcgacatgatgcagccg
ttgaccaagttcacgcggcagatcgtgtcggcggccaccatccccgcacgcattcgtgaa
gccttccgccgtgccgaggaagaacgtcccggcgccgtgcatctggagtttcccgaagat
atcgcccgcgacgatatcgaggacgcgatcctgctgcctaccgaatacgcccgccggcct
tcgccggacgacgccgcactggtgcaggccgccgaggcgatcagcagtgccaaacatccc
atcctgatgatgggtgccgccgccaatcgccaacgtaccgcggtagccctgcgggccttt
atcgacaagctgggtattcccttcttcaccacccagatgggcaagggcgtggtcgatgaa
gatcatccgctttggctgggtaatgccgcactttccgatggtgattttgtgcatcgggcg
atcgatgcggcagacgtgatcatcaacgccggtcatgacgtggtagagaaaccgccgttt
ttcatgcagcgcgggcggcgcactgttatccacatcaatttctcatcggcggaagtggat
gctgtctacttcccgcagatcgaagtggtgggcgatatcgctcataccatcgaacgacta
accgatgcgctggtcaagcaggagcagtgggatttcagctacttcgacaaagtgcgccac
gccttccaggagcagctacagcaatacacccatgaagcacgcttcccgatgcacccggtg
cgcatcgttagcgacacccgcaagtacatgcccgatgatggcatcctgtgcctggacaac
ggcatgtacaaactgtggtatgcgcgttactacaaggcacgccaacctaatacagtgctg
ctcgacaacgcactcgccaccatgggtgccggcctgccttccgcgatggccgcgaagatg
gtgtatcccgaacgcaaggtgctggcgatctgcggcgacggcggcttcatgatgaatgcg
caggagctggaaactgccgtacgcctgaagatggatctggtgatcctgctggtgcgcgac
gatgcctacggcatgatccgctggaagcaggccgacatgggctttgccgatttcggcatg
caattcagcaaccccgatttcgtggcttttgccgaagcgcatggcgcgcatggacatcgt
cccgaacgtgcggatgaatttctgccggcattgcagcgcgctttcgacgaaggtggcgtg
cacttgatcgaccttgccatcgactattccgacaaccatcgcgtgctggacgaagaaatc
cgtcgcctgagcgccgcagtctaa

DBGET integrated database retrieval system