KEGG   Dyella sp. M7H15-1: EO087_15175Help
Entry
EO087_15175       CDS       T05846                                 

Definition
(GenBank) ribose-phosphate diphosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00030  Pentose phosphate pathway
dye00230  Purine metabolism
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01200  Carbon metabolism
dye01230  Biosynthesis of amino acids
Module
dye_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EO087_15175
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EO087_15175
Enzymes [BR:dye01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     EO087_15175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: QAU25562
UniProt: A0A410UMQ7
Position
3308255..3309193
Genome map
AA seq 312 aa AA seqDB search
MLFAGNAHRALAEDVAHRLGVPLGKALVGKFSDGEVQIEIEENVRRQEVFVLQPTGAPSA
ENLFELLTLVDALKRASAASVTAVIPYFGYARQDRRPRSARVPITAKLVARLIGTAGVDR
VLTVDLHADQIQGFFDVPVDNVYASPILLADIWRSYSMDDLIVVSPDVGGVVRARAIAKR
LDDADLAIIDKRRPKANVATVMNIIGDVEGKTCVMVDDIVDTAGTLCAAAAALKERGARK
VVAYCVHPVLSGAAIRNIEGSQLDQLVVTNTLPLREDAKGCAKIRQLSVAELLAETIRRI
AFGESVSSLYID
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttgccggcaacgctcaccgtgccttggctgaagatgtcgctcatcgactgggg
gtgccgctgggcaaggcgctcgtcggcaagttcagcgacggtgaagtgcagatcgagatc
gaagagaatgttcgtcggcaggaagtgttcgtgctgcagcctacgggggcaccgagcgcc
gagaatctgttcgagctgctgaccctggtcgatgcgctcaagcgtgcttccgccgccagt
gttaccgcggtcattccctatttcggctacgcccgccaggatcgccgtccacgctcggct
cgcgtgccgatcaccgccaagctggtcgcccgcctgatcggcacggccggtgtggaccgc
gtgctgacagtggatctgcacgctgaccagatccagggcttcttcgatgtgccggtggac
aacgtctacgcctcgccgatcctgttggccgacatctggcgcagctacagcatggacgac
ctgatcgtggtcagtccggacgtaggcggcgtggtccgcgcccgcgccatcgccaagcgc
ctggacgacgccgacctggccatcatcgacaagcgccgtcccaaggccaacgtggccacc
gtgatgaacatcatcggcgatgtcgaaggcaagacttgcgtgatggtggacgatatcgtc
gataccgccggcaccttgtgtgccgctgcggccgccttgaaggagcgtggcgcccgcaag
gtggttgcctattgcgtgcacccggtgctgtctggcgcggcgatccgcaatatcgaaggt
tcccagctcgaccagctcgtagtgaccaatacgctgccgctgcgtgaggacgctaagggc
tgcgccaagatccgtcagctttcggtggccgagctactggccgagacgatccgccgtatt
gcctttggtgagtcggtcagttcgctctacatcgactaa

DBGET integrated database retrieval system