KEGG   Dyella sp. M7H15-1: EO087_15585Help
Entry
EO087_15585       CDS       T05846                                 

Definition
(GenBank) bifunctional aspartate kinase/diaminopimelate decarboxylase
  KO
K12526  bifunctional diaminopimelate decarboxylase / aspartate kinase [EC:4.1.1.20 2.7.2.4]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00260  Glycine, serine and threonine metabolism
dye00261  Monobactam biosynthesis
dye00270  Cysteine and methionine metabolism
dye00300  Lysine biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01230  Biosynthesis of amino acids
Module
dye_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
dye_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EO087_15585
   00270 Cysteine and methionine metabolism
    EO087_15585
   00300 Lysine biosynthesis
    EO087_15585
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    EO087_15585
Enzymes [BR:dye01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     EO087_15585
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     EO087_15585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Orn_Arg_deC_N Orn_DAP_Arg_deC ACT TFR_dimer
Motif
Other DBs
NCBI-ProteinID: QAU25236
UniProt: A0A410ULX6
Position
3393565..3396177
Genome map
AA seq 870 aa AA seqDB search
MTSHAPAPLTSGAPWIVMKFGGTSVATLPRWQNIRELVASRRAEGARVLVVVSALTGITD
ALKQMCAQEDKGKRIEAAKAIAQRHYDLLDHMQITVPETLAERLRELGKLAEEGPAVLGE
LAWSALVQAHGELMSSALGAAFLSHSGLLTQWVDARDCLGAVALPNQNERTKLLSAMVEA
KPDPALNARLAKLGEVFITQGFIARESQGRTVLLGRGGSDTSASYFGALLKAQRVEIWTD
VAGMFTANPRQVQGARLLQKLDYEEAQEIASTGAKVLHPRCLSSLREPRVPMLIKDTNRP
ELEGTVIGPEVREHAPSVKAISARKGLTLVSMESVGMWQQVGFLADVFAHFKQHGLSVDL
IGSAETNVTVSLDPTENLLDSDAVAALASDLSKVCRVKVIAPCAAITLVGRGMRSMLHTL
SGVLAEFGQLRVHLISQSSNNLNLTFVVDESVVDELIPRLHEMLIAAGALRTDDSALFGP
SWQTLYGSGETLTVGDAWWRTQCRDQLLALGAQATPRYVYHLPTVREQARELKSITAVDR
MHYAVKANTHPAILQALAEEGFGFECVSPGELKAVMAVVPTSAPLLFTPNFAPREDYAWA
LSTRAMVSLDSLYPLEHWGDVFRGCEIVLRVDLGRGLGHHEKVRTGGSGSKFGLPVDQID
AFLRLADAHGVMVRGLHAHLGSGILDAKHWGEVYNQLASLAERIGSVAFLDIGGGLGVPS
HPGEARLDIDALDEVLRKVKSAYPHYPLWMEPGRYLVADAGVLITRVTQQKGKGSWRYLG
VDTGMNSLIRPALYDAWHEIVNLTRLDEPATTLYQVVGPICESGDVIGSDRRLPEAKEGD
VMLIAQAGAYGKVMSSPYNLRDEAEEIILE
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcccatgcccccgcgccgcttacctccggtgcaccctggatcgtgatgaagttt
ggcggcaccagtgtcgccactctgccgcgctggcagaacatccgtgagctcgttgccagc
cgtcgcgccgaaggcgcacgcgtgctggttgttgtgtccgcgctcaccggcatcaccgac
gcactcaaacaaatgtgcgcgcaggaagacaaaggcaaacgtatcgaggctgcaaaagcg
atcgcgcagcgtcactacgacctgctcgatcacatgcagatcaccgtgccggaaacgctg
gccgagcgcttgcgtgagttgggcaagctggccgaagagggtccggccgtgttgggcgaa
ctggcgtggtctgcgctagtgcaggcgcacggcgaactgatgtccagcgcgctcggtgcg
gctttcctcagtcacagtgggttgctcacgcagtgggtggatgcgcgcgactgccttggc
gcggtggcattacctaatcagaacgagcgcaccaagctgctttccgcgatggtcgaagcc
aagcccgatccggccttgaatgcgcgtctggcaaaactcggcgaggtattcatcacgcaa
ggcttcattgcacgtgaatcgcagggtcgtaccgtgctgcttggccgtggcggctccgat
acgtccgcctcgtatttcggtgctcttctgaaagcgcagcgcgtggaaatctggaccgac
gtggccggcatgttcaccgccaatccgcgccaggttcagggtgcgcgtctgttgcagaaa
ctggattacgaggaagcacaggaaatcgcttccaccggcgcgaaagtgttgcatccgcgc
tgcctatcgtcgctgcgcgaaccacgcgtaccgatgctgatcaaggacaccaaccggccc
gagctagaaggcacggtgattggtccggaagtgcgcgaacacgcacccagcgtcaaagcc
atcagcgcgcgtaagggcctgacgctagtatcgatggaatcggtggggatgtggcaacag
gttggctttctggccgacgtatttgcgcacttcaagcagcatggcctgtcggtggatttg
atcggttcggccgaaaccaacgtgacggtgtcgctcgatcctaccgaaaatctgctcgat
tccgatgccgtcgctgccttggccagcgatctgtccaaggtatgccgggtaaaggtgatc
gcgccgtgtgcggccatcacgctggtcggccgtggcatgcgttccatgctgcataccttg
tccggcgtgttggcggagttcggccagttgcgcgtgcacctgatctcgcagtcgtccaac
aacctcaatctcaccttcgtggtggatgagagtgtcgtcgacgaactgataccgcgcctg
catgaaatgctgatcgccgccggtgctttgcgtaccgacgacagcgccttgttcggcccg
agctggcaaacgctgtacggcagtggtgaaaccttgaccgttggcgatgcttggtggcgt
acgcagtgtcgcgatcagttgctcgcgctaggtgcgcaagccacgccacgctatgtctac
catctgccgactgtgcgcgaacaggcacgtgagctgaaatcgattacggcagtggatcgg
atgcattacgcggtcaaggcgaatacgcatccggccatcctgcaagcgttggccgaagaa
ggtttcggcttcgaatgcgtgtcgccaggtgaattgaaagcggtgatggccgtcgtgccg
acatcggcgccgttgttgttcacgccgaacttcgcaccgcgcgaggattacgcctgggcg
ttaagcacgcgtgcgatggtgtcgcttgattcgctttatccgctggaacactggggcgat
gtttttcgcggatgcgagatcgtgctgcgtgtcgatctgggccgtggtctgggtcatcac
gaaaaggtgcgcacgggtggcagcggcagcaaattcgggttgcccgtcgaccagatcgat
gcgttcctgcggcttgccgatgcacatggcgtaatggtgcgaggcctgcacgcgcatctc
ggctccggcattctcgatgccaagcattggggcgaggtctataaccagctcgccagcctg
gccgagcgcatcggcagcgtggctttccttgatatcggcggcggtcttggcgtgccctcg
catcctggcgaggcgcggctggatatcgatgcgctggacgaggtgctgcgcaaggtcaaa
tcggcctatccgcactacccgttgtggatggagccaggtcgttacctagtcgccgatgct
ggcgtgctgatcacccgcgtcacccagcagaagggcaagggttcctggcgctaccttggt
gtggataccggtatgaacagtctgatccgccccgcgctctacgatgcctggcacgagatc
gtgaatctcactcgcctcgacgagcctgccaccacgttgtaccaggtggttggccccatc
tgcgaaagcggtgacgtcatcggttccgaccgtcgcctgccggaagcgaaggagggcgac
gtgatgctgatcgcccaggcaggtgcctacggcaaggtgatgtcctcgccgtacaatctg
cgggatgaggcggaagagatcatccttgagtaa

DBGET integrated database retrieval system