KEGG   Dickeya zeae EC1: W909_00240Help
Entry
W909_00240        CDS       T03567                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
dzc  Dickeya zeae EC1
Pathway
dzc00051  Fructose and mannose metabolism
dzc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dzc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    W909_00240
Enzymes [BR:dzc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     W909_00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh
Motif
Other DBs
NCBI-ProteinID: AJC64622
UniProt: A0A0A8F858
Position
56090..57238
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGVGLTFADVNQPLLDAINQHGSYPVRIVGEQQRVETV
SQVSAVHSGGTQAVTLIAEVDLVTTAVGPQILAKIAGTIAQGLIKRQENGNTAPLNIIAC
ENMVRGTSQLKQHVLAQLPEETQAWVAQHVGFVDSAVDRIVPPADAGESNPLAVTVETFS
EWIVDKTQFNGEPPAITGMELTDNLMAFVERKLFTLNTGHAITAYLGQRAGHGTIRDAIL
DPAIRRVVQGAMEESGAVLIRRYGFDAEKHQAYIRKILTRFENPWLHDEVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHDNLIQGIAAAMHYRSEQDSQAQELAALIATQGPQVALAQ
ISGLDADSEVVGKAVSVYNAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggggccggtaacattggccgtggttttatcggcaagctgctg
gcggatgcaggcgttggcctgacgtttgcggatgtgaaccagccgttgctggatgccatc
aatcagcacggtagttatccggtgcggattgtcggtgaacagcagcgtgtggaaacggtc
agccaggttagcgcggtacacagcggtgggacgcaagcggtcacgctgattgccgaggtt
gatttggtgacaacagcggtggggccgcagatcctggcgaagattgccggtaccattgct
caggggttgataaagcgtcaggaaaacggcaataccgcgccgctgaatatcatcgcctgt
gagaacatggtgcgtggtaccagccagctcaaacagcatgtgctggcgcaactgccggaa
gagacgcaggcgtgggtggcacagcatgtcggctttgtggattcagcggtagaccgtatt
gtacctcctgccgatgcgggcgaatccaacccgctggcggtgacggtggaaaccttcagt
gaatggatcgtggataaaacccagttcaacggtgagccgccggcgataaccggtatggaa
ctgaccgataacctgatggcttttgttgagcgtaagctgttcaccctgaataccggccat
gcgattactgcctatcttggtcagcgtgccgggcacggtaccattcgtgacgccattctg
gacccggccatccgccgtgtggtgcaaggggcgatggaagagagcggtgccgtattgatt
cgtcgctatggttttgatgccgagaaacatcaggcttatatccgcaaaattcttacccgg
ttcgaaaacccgtggttgcacgatgaagtcgagcgtgttggccgtcagccgctgcgtaaa
ctcagcgcaggtgatcgcctgatcaagccgttgctgggtacgctggagtatggcttgccc
catgacaacctgatccaggggattgccgctgcgatgcattaccgtagcgagcaggactcg
caggcgcaggaactggcggcgttgatagccacacaagggccacaggttgcgctggcgcag
atttctggtctggatgctgatagcgaggttgtcggaaaagcggtgagtgtgtataacgcc
atgcagtaa

DBGET integrated database retrieval system