KEGG   Dickeya zeae EC1: W909_10025Help
Entry
W909_10025        CDS       T03567                                 

Definition
(GenBank) exodeoxyribonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
dzc  Dickeya zeae EC1
Pathway
dzc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dzc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    W909_10025
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dzc03400]
    W909_10025
Enzymes [BR:dzc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     W909_10025
DNA repair and recombination proteins [BR:dzc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     W909_10025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 AAA_25 AAA_12 AAA_11
Motif
Other DBs
NCBI-ProteinID: AJC66384
UniProt: A0A0A8FC53
Position
complement(2215358..2219056)
Genome map
AA seq 1232 aa AA seqDB search
MTASALPSALDVLRFPLCGSRLIEASAGTGKTFTIAMLYVRLVLGHGGEHAFSRPLNPPD
ILVVTFTDAATRELRDRIRARLAQAAAYFQPGDKDSLAGEDDKIDPLLRDLRADYPLAQW
PDCARKLQLAAEWMDEAAVSTIHSWCNRMLGEHAFDSGSLFNQTLETDQSELLLEVVRDY
WRTFFFPLDASDVLELRDSWAAPEDFYRSVVPLLDYADEIGIDDLPAQIFSTVRDEKTRQ
LAALKAPWTQWCDELRDLLNAAVAEKKADGRKLQARYFDPWLDKLQHWASSDETTLDIGT
GWTRLTPQGLRECWKIPDEAPTHPALSAMETLAQQLSDLPEPRSQLLRHACRWIHQRFRS
EQESRAQMGFQDLLTRLDAALRGDNGERLAQRIRRQFPVAMIDEFQDTDPLQYRIFDTLY
RVATNDPQQGLILIGDPKQAIYAFRGADIYTYLRARRDTDGRHYTLGTNFRSTQAMVDAV
NQVFMQAENRANGAGAFLFRQPEGDNPVPFLPVQANGRDDLWMQEGTPAAALTCWMLETD
EPLSSSEYRQRMAAGCAREMVRLLQQGEQGQAGFVSSDQRWRPVKPGDMAVLVNSGREAM
AVRAHLSARGVRSVYLSDRESVFDSPQAGELHCWLAACADPENDRLLRAALATPLLGLSW
QALDRLNHDEQEWEHRVMQFVRYQQCWRQQGVLPMLRRLLWEFDVPRRLLVADNARALTD
VLHLSELLQQASVHLDGEHALIRYLAEQCQADNPSSDSLKVRLESDADLVKVVTVHKSKG
LEYPLVFLPFACAFRTVSHRDVPLKFHDDDGQLHLELIASDEAVARADHERLGEDLRKFY
VALTRARYALWLGIAPLKGLEKSAPGYLLGAGEPLEAGQLASCLSLWGGPHSQIAPLPEG
DDAVYRAVRETPALGNEPPLPDIRRHRWRITSYSGLQLAPEGQYQERRESAAHDAAAAEV
QSARQETFSEPQDAAERLPPLPTGYDMYSFPRGAVPGSFLHGLLEWAGKEGFAALAMDRP
RVEDQVARRCNRQGWTPWIPMLTDWLMAQLNQPLALPASPAGTVSLAGLTQYQVEMEFWF
ALNQVDTQRLDQQVSTATLAGAPRAPLMRDALNGMLKGFIDLVFEHQGRYYVLDYKSNWL
GADAADYDSARMARAMLDHRYDLQLALYLFALHRLLRSRLPDYDYDRHVGGALYLFLRGS
QAPGGGVYAERPDRALIDSLDRLFSGDTEVTA
NT seq 3699 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgagcgcgttaccttctgcgctggatgtactgcgctttccactctgcggcagt
cggttaattgaagccagcgccggtaccggcaaaacctttaccatcgccatgctgtatgtg
cggctggtgttgggacatgggggtgagcacgccttctcgcgtccgctcaacccgccggac
attctggtggtgacctttaccgatgccgcgacccgcgaactgcgtgaccgtattcgcgcc
cggttggcacaggccgcggcttactttcagccgggcgacaaggacagcttggcgggtgag
gatgacaagatcgatccgctactgcgcgatctgcgcgccgactacccattggcgcagtgg
ccggattgcgcccgcaaactgcaactggcggcggaatggatggatgaagcggcggtgtcc
accatccacagttggtgcaaccggatgctgggcgaacacgcgtttgatagcggcagcctg
tttaatcagacgctggaaaccgaccagagcgaattgctactggaggtggtgcgtgattac
tggcgcaccttctttttcccgctcgatgccagtgatgtgctggagctacgcgatagctgg
gccgcaccggaagatttttatcgcagcgttgtgccgttgctggactatgccgatgagatt
ggcattgatgacctgcccgcgcagatcttcagcaccgtgcgtgatgaaaaaacacgccaa
ctggcggcgctgaaagcgccctggacacaatggtgcgacgagctgcgcgacctgctgaac
gccgccgtggcagagaaaaaagcggatggccgcaagctacaggcccgttatttcgacccg
tggttggataaactgcaacactgggccagcagtgacgagacgacgctggatatcggcacc
ggctggacacggctgacgccacaagggttacgggagtgctggaaaataccggacgaagca
ccgacacatccggcgttaagcgcgatggaaacgctggcgcagcagttgagcgacttgccg
gagccacgtagccaactgttacggcacgcctgccgctggatacaccagcgttttcgctcc
gaacaggaaagccgggcgcagatgggctttcaggacttgctgacccggctggatgccgca
ttacgcggcgataacggcgaacgactggcccaacgcattcgccgccagttcccggtggcg
atgatcgatgaatttcaggataccgacccgctgcaataccgcattttcgataccctgtac
cgggtggcaaccaatgatccgcaacaggggttgatcctgataggcgacccgaaacaggcg
atttacgcgtttcgtggtgccgatatctacacctatttgcgcgcccggcgcgataccgac
ggtcggcattacacgctggggaccaactttcgttccacgcaggcgatggtcgatgccgtt
aatcaggtgtttatgcaagcggaaaaccgtgccaacggcgcaggtgcgtttctatttcgt
cagccagagggcgacaacccggtgccgtttttaccggtgcaggccaacggtcgtgatgac
ctctggatgcaggaaggaacgccagccgcggcattgacctgctggatgctggaaaccgat
gaaccgctgtcgtcgtctgaataccgtcagcgaatggcggcggggtgcgcacgtgaaatg
gtgcgactgttacaacagggcgagcaggggcaggccggttttgtctcgtcagaccaacgc
tggcgtccggttaaaccgggcgatatggcggtgctggttaatagcgggcgcgaggcgatg
gccgtgcgggcgcacctgtccgcgcgcggtgtgcgcagtgtgtatctgtctgaccgggag
tcggtatttgatagcccgcaggcaggagaactgcactgctggttggccgcctgtgctgac
ccggagaacgaccggttgctacgcgccgcgctggccacgccgttactggggctgagctgg
caggcgcttgaccgccttaaccacgacgagcaggagtgggaacaccgggtgatgcaattt
gttcgctaccagcaatgctggcgtcagcaaggcgtgttgccgatgctacggcggttgcta
tgggagtttgatgtcccgcgtcggttgctggttgccgataacgcccgggcgttgaccgat
gtgctgcacctgtcggagttactgcaacaggccagcgtgcatctggacggcgaacacgcg
ttgatccgctatctggctgaacagtgccaggccgataaccccagcagcgatagcctgaaa
gtgcggctggaaagtgacgcggatctggtcaaagtggtgaccgtgcataaatcgaaaggg
ctggagtacccgctggtgtttctgccgttcgcctgtgcgttccgcacggtcagccatcgg
gatgtgccgctgaaatttcatgatgatgacgggcaactgcaccttgagttgattgccagc
gacgaggcggttgcgcgtgctgaccatgagcgcctgggggaagacctgcgtaagttttat
gtcgcattgacccgtgcgcgctatgcgctgtggcttgggatcgcgccgttgaaagggctt
gagaaaagcgcgcccggttacctgctcggtgccggtgaaccattggaggccgggcaactg
gcgtcatgcttgtcgctctggggcgggccacacagccagatagcgccactgccagaaggc
gatgacgcggtatatcgcgcggtacgggaaacccccgcgctgggaaacgagccgccgtta
ccggatattcgccgtcaccgttggcgcatcaccagttattccgggctgcaactggcaccg
gaggggcagtatcaggagcgacgtgagtccgctgcccatgacgccgctgctgctgaagta
cagagcgcccggcaggaaacctttagcgaaccgcaggacgccgcagaacgtctgccgcca
ttgccgaccggctacgacatgtacagttttccgcgcggtgcggtgccgggcagttttcta
catgggctgctggagtgggcgggtaaagaggggtttgccgctctggcaatggatcgcccg
cgagtggaagatcaggtggcgcgacgctgtaaccgacagggctggacaccgtggataccg
atgctgactgactggctgatggcgcaactcaaccaaccgctggcgttgcccgcatcaccc
gctggtacggtgtcactggctggtctgacgcagtatcaggtggaaatggagttctggttt
gcgctcaatcaggtcgatacgcaacgtctggaccaacaggtcagcaccgccacactggcg
ggggcaccacgcgcgccgctgatgcgtgacgcgctcaatggcatgctgaaaggctttatc
gatttggtgtttgaacatcaggggcgctactacgtgctggattacaagtccaactggctg
ggggcggacgccgccgactatgactcagcgcgtatggcgcgcgccatgctagaccatcgg
tatgatctgcaactggccttgtacctgtttgccttgcaccgcttactacgctcacgactg
ccagattatgactacgaccgtcatgtcggtggggcgttgtatctgttcctgcgcggtagt
caggcaccggggggcggtgtttacgctgaacgaccggatcgggcgctgattgattcgctg
gaccgcctgtttagcggtgatacggaggtaacggcatga

DBGET integrated database retrieval system