KEGG   Dickeya zeae EC1: W909_14100Help
Entry
W909_14100        CDS       T03567                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
dzc  Dickeya zeae EC1
Pathway
dzc00561  Glycerolipid metabolism
dzc00640  Propanoate metabolism
dzc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dzc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    W909_14100
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    W909_14100
Enzymes [BR:dzc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     W909_14100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase ABC_sub_bind DAGK_cat DUF3606
Motif
Other DBs
NCBI-ProteinID: AJC67146
UniProt: A0A0A8FFJ2
Position
complement(3092529..3093620)
Genome map
AA seq 363 aa AA seqDB search
MTQQVFFPATVLRGVGVSQQLGAVCARFGSRVLVAGGHQALAAAQTVIIEQLRQAGVTLT
AVEWSGEQCSVSQIERLCARVRETDSDLILAVGGGKALDTGKAVAFQCGIPVVTLPTIAA
TCAAVTPLSVRYHDDGHFHDLYHLPVAPAAVVIDSALLVRAPLRWLAAGLGDTLAKWYEF
RAIDKGDDSNGFAASSRANSEICFRLIAQHGEAACRAVMEGQANDALDQVLDAIFLFAGL
TSLMASGAHAAASHALYEGFTVCDKTREFGHGLLVGFGNLCLLALEQRSDEELLEAIRLA
HACAVPLTLAAICPDLSDDELAAIIRASIDAPDMANMPFNVTESQLHQAIRRVEALAVRV
TAG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaggttttctttcccgccaccgtgttacgtggcgtcggggtcagtcagcag
ttgggggcggtatgcgcccggttcggtagtcgggttctggtggccggagggcatcaggcg
ctggccgccgcacaaaccgtgatcattgagcaactgcggcaggccggggtgacgctgacg
gcggtggagtggtccggtgagcaatgcagcgtcagtcagatagaacggttgtgtgcgcgg
gtgcgtgaaaccgacagcgatctgatcctggcggtgggcggcggtaaagcgttggataca
ggcaaagcggtggcgtttcagtgtggcattccggtggtgacattgccgacgattgcggct
acctgcgcggcagtgaccccgctgtcggtgcgttaccatgatgacggccatttccacgat
ttgtatcacctgccggtggcccccgctgccgtggtgatagacagcgcgctgctggtacgc
gccccactgcgctggctggcagccgggctgggggatacgctcgccaagtggtatgagttc
cgtgcgattgataaaggtgacgacagcaatggctttgcggcgtcatcacgggctaacagc
gagatctgctttcggttgatagcacagcacggcgaggccgcttgccgggcggtgatggaa
gggcaagccaatgacgcgctggaccaggtgctggatgccatcttcctgtttgccggtctg
acatcgttgatggccagtggcgcacatgccgcagcctcccatgcgttgtatgaagggttt
accgtgtgtgataaaacccgtgaatttggtcacggcttgctggtcggttttggcaatttg
tgtctgctggcgctggaacagcgtagcgatgaggagttgctggaagcgattcggctggcg
catgcctgtgcggtaccgctgacactggcggctatctgcccggatctgtcagacgacgaa
ctggcggcgattattcgtgcctcgattgatgcgccggatatggcgaacatgccgtttaac
gtgacggagtcacagttgcatcaggcgatacgccgggttgaagcgctggccgtgcgcgtc
accgccgggtaa

DBGET integrated database retrieval system