KEGG   Dickeya zeae EC1: W909_17495Help
Entry
W909_17495        CDS       T03567                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
dzc  Dickeya zeae EC1
Pathway
dzc00270  Cysteine and methionine metabolism
dzc00480  Glutathione metabolism
dzc01100  Metabolic pathways
Module
dzc_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:dzc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    W909_17495
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    W909_17495
Enzymes [BR:dzc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     W909_17495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AJC67770
UniProt: A0A0A8FLA0
Position
3848229..3849182
Genome map
AA seq 317 aa AA seqDB search
MRKLGIVMDPISSINIKKDTSFAMLQEAQRRGWELHYMEMGDLYLHAGEARATTRTLSVK
YDYDHWYDFGATQDIALHELDVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR
DCNEKLFTAWFPQLTPDTLVTRNADRLRAFHQHHSDVILKPLDGMGGASIFRLKPEDANV
SVIIETLTEHGSRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG
RGEARPLSESDWQIARTVAPVLKQKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAYPDV
SITGMLMDAIDRRLAQR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactcggtatcgtgatggacccgatttcgtccatcaatatcaagaaagacacc
agctttgcgatgttgcaggaagcccagcgtcgcggctgggaactgcactatatggaaatg
ggcgacctctacctgcacgcaggtgaagcccgagccaccacccgcacgttgagcgttaaa
tacgattacgaccattggtatgacttcggtgcgacgcaggacatcgccctgcatgaatta
gatgtggtgttgatgcgcaaagacccgccttttgacaccgaattcatctacgccacctat
attctggagcgggcggaagagaaagggacgctcatcgttaacaaaccgcaaagcctgcgc
gattgtaacgagaaactgttcaccgcctggttcccgcagttaacgccagatacgctggtc
acccgcaatgccgatcggctgcgtgcgttccatcagcaccacagcgatgtcatattaaaa
ccactcgatggcatgggcggcgcgtcgattttccgcctgaagccagaggatgctaacgta
tcggtcattatcgaaacgctgaccgaacacggtagccgttactgcatggcgcaaaactac
ctgcctgccattaaagacggcgataaacgcgtactggtggtcgatggtgaacccgtgcct
tactgcctggcacgcattccgaaaagcggtgaaacccgtgggaatctggctgctggtggt
cggggcgaagcccgcccgctcagcgaaagcgactggcagattgcccgtaccgtcgcgccg
gtactgaaacagaaaggcttgatcttcgtcgggctggacatcattggcgatcgcctgacc
gaaattaacgtcaccagcccaacctgtgtgcgtgaaatcgaagccgcctatccggatgtc
tctattactggcatgctgatggacgcgattgaccgcaggctggctcagcgttaa

DBGET integrated database retrieval system