KEGG   Dickeya zeae EC1: W909_17945Help
Entry
W909_17945        CDS       T03567                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dzc  Dickeya zeae EC1
Pathway
dzc00620  Pyruvate metabolism
dzc00630  Glyoxylate and dicarboxylate metabolism
dzc01100  Metabolic pathways
dzc01110  Biosynthesis of secondary metabolites
dzc01120  Microbial metabolism in diverse environments
dzc01200  Carbon metabolism
Module
dzc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dzc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    W909_17945
   00630 Glyoxylate and dicarboxylate metabolism
    W909_17945
Enzymes [BR:dzc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     W909_17945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AJC67854
UniProt: A0A0A8FGF8
Position
complement(4010104..4011702)
Genome map
AA seq 532 aa AA seqDB search
MTQQTISRELVFTAALGDAERQILTTEAVDFLTALVSRFTSQRNHLLAERQVIQARIDSG
ELPGFISEMDSIKNSDWKVRGIPNDLLDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWSKVIEGQINLRDAVRGSIAYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVLWND
EPIPGSLFDFALYFFHNYRQLLAKGSGPYFYLPKTQSWQEAAWWSEVFSYTEDQFGLARG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQSV
TMDKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKEAERNAWVQEKVRQDKELEARNGH
DGTWIAHPGLADTVMPVFDRLLGDRPNQLDVLREDDAPVTADELLAPCPGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHGKTLSDGRVVTKALFCQ
MLAEEMQVIRSELGDTRFDSGRFEEAGRLMERITTQDALIDFLTLPGYDLLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacagacgataagcagggaactggtattcaccgcagcgttaggtgacgcggaa
cggcagattctgacgacggaggcggttgattttctcactgcgctggtaagccggtttaca
tcgcagcgcaatcacctgctggccgaacgtcaggtaatacaggcgcggattgatagtggt
gaattaccgggttttatttcggaaatggattccataaaaaattctgactggaaagttcgt
ggtattccgaatgacttgttggatcgccgggtagagattaccggcccggtggaacgcaaa
atggtgattaacgccctgaacgccaatgtgaaagtcttcatggcagactttgaagactca
ctggcacccagttggtcaaaagtgatcgaggggcaaatcaacctgcgtgacgcggtacgt
ggctccatcgcctacaccaacgaggcgggaaagatttatcagctcaagcccaatcccgcg
gtgttgatttgtcgggttcgtgggttacacctgccggaaaaacatgtgctgtggaatgat
gagcctatccccggcagcctgtttgatttcgcgctctattttttccacaactaccgccaa
ctgttggcaaaaggcagcggcccgtatttctatttgccgaaaacccaatcctggcaggaa
gcagcctggtggagcgaggtgttcagttacaccgaagaccagttcggtttagcgcgcggc
actattaaagcgacggtattgattgaaaccttgcctgctgtgttccagatggacgagatc
ctgtatcacctgcgtgaccatatcgttgggctgaactgcggccgttgggactatatcttc
agttacatcaaaacgttgaagaatcacccggaccgcgtattaccagaccgccagtcggta
acgatggacaaaccgttcctgagcgcttactcgcgtttgctgatcaaaacctgtcaccgg
cgcggtgcatttgctatgggggggatggctgcattcatacccagcaaagaggcggagcgt
aacgcatgggtgcaagagaaggtcaggcaggacaaagagctggaagcgcgcaatggtcat
gatggcacctggattgcccaccccggtttggctgacaccgtgatgccggtgtttgaccgc
ttgctgggtgatcgccccaatcagttggatgtgctgcgtgaagatgatgccccggtaacc
gctgatgaactgctggccccttgcccaggtgagcgtaccgaagcgggtatgcgtgccaat
atccgcgtagccgtgcaatacatcgaagcctggatttccggcaacggttgcgtaccgatt
tacggtctgatggaggacgcggccaccgcagagatctcccgcacctccatctggcagtgg
attcaccatggcaaaaccctcagtgatggccgcgtggtgaccaaagccttgttctgccag
atgctggctgaagagatgcaggttatccgtagtgagctgggtgacacccgcttcgatagc
ggtcgcttcgaggaagcaggcagactgatggagcgtatcaccacgcaagacgcgctaatc
gattttcttaccttacccggttacgacttacttgattaa

DBGET integrated database retrieval system