KEGG   Dickeya chrysanthemi: Dd1591_0024Help
Entry
Dd1591_0024       CDS       T00930                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00010  Glycolysis / Gluconeogenesis
dze00052  Galactose metabolism
dze00500  Starch and sucrose metabolism
dze00520  Amino sugar and nucleotide sugar metabolism
dze00521  Streptomycin biosynthesis
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
dze01130  Biosynthesis of antibiotics
dze01200  Carbon metabolism
Module
dze_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dze_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd1591_0024
   00052 Galactose metabolism
    Dd1591_0024
   00500 Starch and sucrose metabolism
    Dd1591_0024
   00520 Amino sugar and nucleotide sugar metabolism
    Dd1591_0024
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dd1591_0024
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dd1591_0024
Enzymes [BR:dze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dd1591_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACT04918
UniProt: C6CFH7
Position
27141..28109
Genome map
AA seq 322 aa AA seqDB search
MHQYALVGDVGGTNARLALCELANGKLSHSKQYAVQQHDSLEEAIRLFLAEHAELTIKEA
CIAIACPVTDDWVEMTNHHWAFSIAAMRQSLGFERLAVINDFTAVSMAIPALTQEDVIQL
GGAAPVAGKPVAVYGAGTGLGVAHLLPVDGKWLSLPGEGGHVDFAPNSEEEDILLQVLRQ
ELGHVSAERVLSGPGLVNIYRAIVKADDRVPEALTPQIVSERALAHSDVDCLRALSLFCV
LMGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFRNSGFRSAFEDKGRFRDYLADIPVFMI
SHPQPGLLGAGAYLRQALGQTL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagtatgcgctggtaggtgacgtcggtggcaccaacgcacgtcttgcgctgtgt
gaactggcgaatgggaagttgtcgcacagcaagcagtacgcggttcagcagcatgacagt
ctggaagaggcgattcgcctgtttctggcggaacacgcggagctcaccatcaaagaagct
tgtattgccatcgcctgcccggtgaccgacgactgggtggagatgactaatcatcactgg
gcgttttcgattgccgccatgcggcagagcctggggtttgaacgcctggcggtgatcaac
gactttaccgccgtcagcatggcgattccggcgttgacgcaggaagatgttattcaactg
ggtggcgcagcgcccgtcgcgggcaagccggtggcggtatacggtgccggaaccgggctc
ggcgtggcgcacctgttaccggtggacgggaaatggctcagcctgccgggcgaaggcggt
cacgtcgattttgcgccgaatagcgaagaagaggacatcctgttgcaggtgttgcgtcag
gaactgggacatgtctccgccgagcgcgtgctgtccggaccggggctggtgaatatttac
cgggcgatcgttaaagcggacgaccgggtgccggaagcgctgacgccgcagatagtgtct
gaacgggcgctggcgcacagcgatgtcgactgtctgcgtgcgttgtcgctgttttgcgtg
ctgatggggcgctttggcggcaatctggcgctgaatctcggcaccttcggcggcgtttat
atcgccggcggcattgtgccgcgttttctggaattcttccgcaactccggttttcgtagc
gcgtttgaagacaaaggccgcttccgtgattatctggccgatattccggtgttcatgatt
tctcacccacagccagggttgctgggtgcgggcgcgtatttgcgtcaggcattgggccag
acgctgtaa

DBGET integrated database retrieval system