KEGG   Dickeya chrysanthemi: Dd1591_0053Help
Entry
Dd1591_0053       CDS       T00930                                 

Definition
(GenBank) Mannitol dehydrogenase domain protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00051  Fructose and mannose metabolism
dze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Dd1591_0053
Enzymes [BR:dze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     Dd1591_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA ApbA_C
Motif
Other DBs
NCBI-ProteinID: ACT04946
UniProt: C6CFW3
Position
62439..63590
Genome map
AA seq 383 aa AA seqDB search
MMKALHFGAGNIGRGFIGKLLADAGIALTFADVNQPLLDAINQRGCYPVRIVGEQQRVET
VNQVNAVHSGSPQAVELIAEVDLVTTAVGPQILAKIAGAIAQGLVKRQESGNTSPLNIIA
CENMVRGTSQLKQHVLAQLPENTQAWVAQHVGFVDSAVDRIVPPAEAGESDPLAVTVETF
SEWIVDKTQFTGEPPAIAGMELTDNLMAFVERKLFTLNTGHAITAYLGQRAGHGTIRDAI
LDPAVRQVVQGAMEESGAVLIRRYGFDADKHQAYIRKILTRFENPWLHDEVERVGRQPLR
KLSAGDRLIKPLLGTLEYRLPHDNLIQGIAAAMHYRSEQDPQAQELAALIASEGLQAALA
QISGLDADSEVVGKAVSVYNAMQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagcattacattttggggccggcaatatcggccgtgggtttatcggcaagctg
ctggcggacgccggcattgccctgacgtttgccgatgtgaatcagccgttgctggatgcc
atcaatcagcgtggctgctatccggtgcggattgtcggcgaacagcagcgtgtggaaacg
gtcaatcaggttaatgcggtacacagcggcagcccgcaggcggttgaactgattgccgag
gttgacctggtgacgacggcggtggggccgcagatactggcgaagatcgccggggcgatt
gctcaggggctggtgaagcgtcaggaaagcggtaatacgtcgccgctgaatatcattgcc
tgcgagaacatggtgcgaggcaccagccagctcaaacagcatgtgctggcgcaactgccg
gagaatacacaagcgtgggtcgcgcagcatgtcggtttcgtggattcggcggtagaccgt
attgtgccgccggccgaagcgggtgaatccgacccgctggcggtgacggtggaaaccttc
agtgaatggatcgtggataaaacccagtttaccggcgagccgccggcgatcgccggtatg
gagctgaccgataacctgatggctttcgttgaacgcaagctgttcaccctcaacaccggc
catgcgattaccgcctatctcggccagcgtgccgggcacggcaccatccgcgatgcgatt
ctggacccggctgtccgccaggtcgtgcagggtgcgatggaagagagtggcgccgtactg
attcgtcgctatggttttgatgccgataagcatcaggcttatatccgcaaaattcttacc
cgttttgaaaacccgtggctgcacgacgaggtggaacgcgtcggccgtcagccgttgcgt
aagctcagcgccggcgatcggctgatcaaaccactgctgggcacgctggaataccgcctg
ccgcacgataatctgatccaggggattgccgcggcgatgcactaccgtagcgagcaggat
ccgcaggcgcaggagctggcggcgttaattgcttccgaggggctgcaggctgcgctggcg
cagatttcaggtctggacgctgatagcgaggttgtcggaaaagcggtgagtgtgtataac
gccatgcaataa

DBGET integrated database retrieval system