KEGG   Dickeya chrysanthemi: Dd1591_0223Help
Entry
Dd1591_0223       CDS       T00930                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00500  Starch and sucrose metabolism
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dd1591_0223
Enzymes [BR:dze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dd1591_0223
Exosome [BR:dze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dd1591_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ACT05116
UniProt: C6CGP7
Position
267334..269517
Genome map
AA seq 727 aa AA seqDB search
MSGFSDRNIINLLFSGHYADPFAVLGMHVTSSGLEVRALLPDASDVHVVDAHSGRKVAHL
QRLDPRGFFVAVIPRRKKPFSYRLAVTWQQDTHVIDDPYRFGPLLQELDIWLLAEGRHLR
PFETLGAHPSTLDGVGGTCFAVWAPNAQRVSVVGDFNFWDGRRHPMRLRCENGVWELFVP
GVGVGQLYKFEIIDCYGNVLVKSDPYAFASQMRPDTASVVSALPPALPVDEARQSANDLQ
SPISIYEVHLGSWRRHDDNNFWLSYRELADQLVPYVKDMGFTHVELMPVHEHPFDASWGY
QPLGLYAPTRRFGSPEDFRYLVSAFHEAGINVLLDWVSGHFPTDSYGLARFDGTALYEYA
DPKEGYHQDWNTLIYNFDRHEVRNYLAGNALYWTERFGVDGLRVDAVASMIYRDYSRRDG
EWVPNHYGGKENLEAIGFLRYTNQMLGQNRAGAVTIAEESTDYAGVTLPPEHSGLGFHYK
WNMGWMHDSLAYMQQDPVHRKYHHDLLTFGMLYAYSENFVLPLSHDEVVHGKRSLLDRMP
GDAWQKFANLRAYYGFMWAYPGKKLLFMGGEFAQGREWNHDTSLDWHLLDEPEGWHVGVQ
QLVRDLNHCYRQHPPLYQCDYLHQGFEWVVVDDRENSVFAFIRRDAEGNEILIISNFTPV
PREGYRVGINQPGHWREVLNTDSMHYHGSNLGNQGLVRSEAVGSHSRPQSLVLTLPPLST
LYLVKEA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggattttccgatcggaacatcattaatctccttttttccggccattacgccgat
ccttttgcagtattgggtatgcacgtcacctcgtcaggcttggaagttcgtgcgctgctt
ccggatgccagcgatgtacacgtggtagacgcacacagcggacgtaaagtcgcacacctg
cagcgcctggacccgcgcggttttttcgttgcggtgatccctcgtcgtaaaaaaccgttc
agctatcggctggcggtgacctggcagcaagatacgcatgtgattgacgacccttatcgt
tttggcccgttgttgcaggagctggatatctggctgctggcggaggggcgccatttgcgg
ccgtttgaaacattgggcgcgcatccgtccacgctggatggcgtcggcggcacctgcttc
gccgtctgggcgccgaatgctcagcgggtgtcggtggtgggtgatttcaatttttgggat
gggcgccgccacccgatgcggctgcggtgcgagaacggcgtgtgggagctgtttgtgccg
ggcgtcggggtcgggcagttgtacaaattcgaaatcatcgattgctacggcaatgtgctg
gtgaaatcagacccgtatgccttcgcttctcagatgcgaccggataccgcctcggtggtc
agtgcgttaccgcccgcgttgccggtggatgaggcgcggcaatccgccaacgatttacag
tcgccgatttccatttacgaggtgcatctggggtcatggcggcggcatgacgacaataat
ttctggctcagttaccgcgaactggcggaccaactggtgccgtacgttaaagacatgggg
ttcacccacgttgaactgatgccggtgcatgaacatccgtttgacgctagttggggttac
cagccgctggggctgtatgcaccgacccgccgcttcggctcgccggaggatttccgttat
ctggtcagcgcctttcatgaggcgggcatcaatgtgttgctggactgggtatccggccat
ttcccgacggacagctacggtctggcgcggtttgacggtacggcgctgtacgaatatgcc
gacccgaaagaaggttaccatcaggactggaatacgctgatttataacttcgatcgccat
gaggtgcgtaactatctggcgggtaacgcgttgtactggacggagcggtttggcgtcgac
gggttacgggtagacgcggtggcatcaatgatttaccgcgactacagccgccgcgacggc
gaatgggtgccgaaccattacggcggcaaggagaacctggaggcgatcggctttttacgt
tacaccaaccagatgctgggccagaaccgtgccggagccgtcaccatcgccgaagagtcc
accgattatgccggggtgacgttgccgccggaacatagcgggttgggttttcactataag
tggaacatgggttggatgcacgactcgctggcctacatgcaacaggatccggtgcatcgt
aaataccaccacgacctgctgaccttcggcatgttgtatgcctacagcgagaacttcgtc
ctgccgctgtcgcacgatgaagtggtacacggcaaacgttctttgctggataggatgccg
ggcgacgcctggcagaaattcgccaacctgcgtgcctattacggctttatgtgggcttat
cccggcaagaagctgctgtttatgggcggcgagtttgcacaaggacgggaatggaaccac
gacaccagcctggactggcacctgctggatgagcccgaaggctggcatgtcggcgtgcag
caactggtgcgcgacctcaaccattgttatcgccaacacccgccgctctatcaatgcgac
tacctgcatcagggatttgaatgggtggtggtagacgatcgcgagaactcggtattcgcc
tttatccggcgtgatgccgagggcaacgagatattgattatcagcaactttacgccggtc
cccagagagggatatcgcgtcggcattaaccagccgggacactggcgcgaagtgctgaat
accgattccatgcattaccacggtagtaaccttggcaatcagggattagtgcgtagcgaa
gcggtgggcagccattcccgcccacaatcgctggtgttaacgctgccgccgctctccacc
ttgtatctggtgaaggaggcgtaa

DBGET integrated database retrieval system