KEGG   Dickeya chrysanthemi: Dd1591_0385Help
Entry
Dd1591_0385       CDS       T00930                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00564  Glycerophospholipid metabolism
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
Module
dze_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:dze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dd1591_0385
Enzymes [BR:dze01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Dd1591_0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ACT05275
UniProt: C6CI29
Position
complement(435339..436253)
Genome map
AA seq 304 aa AA seqDB search
MLDRIKIALQHLLPKVWLTQLAGWGADRQAGMITKLVIDLFARIYKVNMQEAQQPDTASY
RTFNDFFVRPLKPGIRPVDPLPNRLVFPADGAISQLGTIDDDRILQAKQHDYSLEALLAG
NYIIADLFRDGLFVTTYLSPRDYHRVHMPCDGILRDMIYVPGDLFSVNPLTAANVPNLFA
RNERVICLFDTPFGPMVQILVGATIVGSIETVWAGVVTPPREGIIKRWAYPMEGEGAVIL
EKGDEMGRFKLGSTVINLFVKDRIQFMPGLASQSVTRMGEAMAEALDEDIQTRMSANDDT
DTTP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgctggacagaatcaagattgctctacaacatctgctcccgaaggtctggctgacgcaa
ctggccggctggggagctgaccgccaggccggtatgatcaccaaactggtgattgacctg
tttgcccgcatctataaggtcaacatgcaggaagcgcagcaaccggatacggcgtcctac
cgtactttcaacgatttcttcgtgcgcccgctgaaaccgggtatccgcccggttgatccg
ctgccgaaccggctggttttccccgccgacggcgccatttcccagttaggcaccatcgac
gacgaccggattttgcaggccaaacagcatgactactcgctggaagcgctgctggccggc
aactacattatcgccgatctgttccgcgacggcttgttcgtcacgacttatctctccccg
cgcgattaccaccgcgtgcacatgccgtgcgacggtattttgcgcgatatgatctatgta
ccgggcgacctgttttccgttaacccgctgaccgccgccaacgtgccgaacctgttcgcc
cgcaacgaacgtgtaatttgcctgttcgatacgccattcggcccgatggtgcagattctg
gtcggcgcgaccatcgtcggcagcatcgaaaccgtctgggctggcgtggttacgccgccg
cgtgaaggcatcatcaaacgctgggcctacccaatggaaggcgaaggcgccgtcattctg
gaaaaaggcgatgaaatgggccgtttcaaactcggctctacggtgattaacctgttcgtg
aaagaccgtatacagttcatgcccggtttggctagccagagcgtgacccgcatgggtgaa
gcgatggccgaagcgctggatgaagacatccagacacgcatgagcgctaacgacgatacc
gacaccaccccctga

DBGET integrated database retrieval system