KEGG   Dickeya chrysanthemi: Dd1591_0417
Entry
Dd1591_0417       CDS       T00930                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
dze  Dickeya chrysanthemi
Pathway
dze03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dze00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dd1591_0417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dze02044]
    Dd1591_0417
Secretion system [BR:dze02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Dd1591_0417
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACT05305
UniProt: C6CF09
Position
480420..480938
AA seq 172 aa
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVQGHEDEMLVQEFKHIVTVPTDPQSGQPA
GQRVHKPFKFTVALNKAVPLLYNALASGEMLPTVTLKWYRTSVEGKQEHFFTTTLTDATI
VDINNQMPHCQDPSKQDYTQLIEVSLAYRKVDWEHTVAGTSGSDDWRAPIEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgctatatcagcatcgaaggtaaaacgcagggtaacatcaccgccggt
gccttcacctccgactccgtcggcaacatctacgtgcagggccacgaagacgagatgctg
gtgcaggaattcaaacacatcgttaccgtcccgaccgacccgcagtccggccagcctgcc
ggtcagcgcgtgcacaagccgttcaagttcaccgtcgccctgaataaagccgtcccgctg
ctgtataacgcgctggcctccggcgaaatgctgccgaccgtgaccctgaagtggtatcgc
acctcggtggaaggcaagcaggagcatttcttcaccaccaccctgaccgacgccaccatc
gtcgacatcaacaaccagatgccgcactgccaggacccgtccaagcaggattacacccag
ctgatcgaagtgtcgctggcctaccgcaaggtggactgggagcacaccgtggccggcact
tccggctctgacgactggcgcgcgccgatcgaagcgtaa

DBGET integrated database retrieval system