KEGG   Dickeya chrysanthemi: Dd1591_0420
Entry
Dd1591_0420       CDS       T00930                                 

Definition
(GenBank) YD repeat protein
Organism
dze  Dickeya chrysanthemi
SSDB
Motif
Pfam: RHS_repeat PAAR_motif RHS
Other DBs
NCBI-ProteinID: ACT05308
UniProt: C6CI62
Position
483390..487817
AA seq 1475 aa
MLNDILSRVARVGAMHAGNRPNPPADRPQPCQGKPPTSPGKTIKHKSFLGALAGAVAGAL
VAAAVFTAAAAVAGAIAVAAIGTGGMGAALVVGVVKLAAGFGAVSLLGGLIDAVSSKVSA
MVDSGSPSFGPVMAGSGNVFVEKQPVARATKDTVACTRHNSPQLIAQGSESVFVNDAPAA
RIDDKTVCGATIKEGASTVFFGSGQGTYLEIAEEFTALQRALLIAVEFLVPPSRGMFRGL
GKLFTRGPMAVLKGMRAGALKTLEGLKSAVKCASEGFRNSRGLSRVTEAVRGFLKDPVYI
ASGEVIESRTDIALGQTLPLVFERTYRSASVHTGLLGRGWHDSWSEVATVTRDGLNTHVV
ITLAQGYDIDFTFHQDVQAVYCPHYPEFTLHRRGDGFSLWHRDQQTWRDFSVVQGERRLL
SAIHDSHDNRIELVRDPKGYLRQVRHSDGVTLLLVWRGEYLHQIQRIDGGQKTLLAEYRQ
DEQGRLVEANATHAYHLYYEYDAAHRLTRWHDNDQTWARYEYDTQGRCVYTTCADGFLTA
RFDYLPDRVVMTDGLGQRSEFGFNDLHLMSWEQSPLGHVTRYEYDEVGNLLREISPAGRV
VEFGYLDDTGRVSTFTDASGHQWRYDYDDALRLCGVTDPLGREWRWVYDAEGNPERLTGP
EASEVRFAWNRYGLLTQVSDAAGEVQARLQYDHRQRLLSATDAESRTQQMRYDMQDRVVQ
WQRADGARFRLGYRRASWALPEQLIRPDDKEEQRQYDRHNNLLSYVDGNGALWRQSFGPF
DLLTARTDAEGHTWRYAYDKESQQLTTVIAPDGSRWQWWLDADGRVVRERDMTGTETHYG
YDEDGLCVSVRNGEGDTRHFLYDARGLLLRETAPDDTLHYRYDAVGRLTEVSSATAHVQL
DYDLRDRVVREWHNGTLLTRQVDDNARTVTRTLTWDGDAGDTTGTLAPLTSLFHYTRTGE
LRQVQLPDGADLTLTYDAAGRESHRRGGSGFVQQREYDVMGWLTREMSGAQHDGHLLAAQ
TREYRYDGAGNLTGVRHNRDAEGYRLDATGRVQAVLSGGAGKPVDTTARFHYTRTGLPQE
AGRLTEWQAGRLVQHDDTHYQYDRAGRLIRKQVVQPGYRPQVWQYRWDSRNQLRVVDTPT
GERWLYRYDPFGRRVGKRCDQKAEETRYQWDGDQIAEIRHYRHGQLVARRHWVYNGWELV
VQQRQHTGGDWETDFVTSSQNGTPQALFTPDGTLRWQAPTATLWGQRQAEKSESPDPGLA
FAGQLRDSESGLCYNRFRYYDPAGGCYVSPDPIGIAGGENNYGYVQNPMCWVDPFGLAGC
SSYLNAWGGRNAKAFKNFWNNSSHADFMKAWNNPAFKKNIKARLRGGGLTNSGGYHEWLP
VSQGDKFKKMGFSFEEYMSLTSPTNKVGFLDKFGNYGSHTSYTGGVTKASAQAHRDLINM
AKLAQTKSGYLGAVQKWSGEHLPFGQFDLPSGFWK
NT seq 4428 nt   +upstreamnt  +downstreamnt
atgctcaacgatattctgagccgggtggcccgggtaggggccatgcatgccggaaaccgt
cccaacccgcccgccgaccggccgcaaccctgtcagggtaaaccgccaacgtcgccgggc
aagaccatcaagcacaagagcttcctgggtgcactggcgggtgccgtggccggggcgctg
gtggcggccgccgtatttaccgccgctgcggccgtggcgggtgctatcgccgttgcggcg
attggcacgggtggaatgggggcggcgctggtggtgggggtggtaaaactggccgccgga
tttggtgcggtcagcctgctgggtgggctgatagacgcggtgtccagcaaggtgtcggcg
atggtggacagcggctcgccatcgttcggaccggtgatggcgggctcgggtaacgtgttt
gtcgaaaaacagccggtggcccgcgccacgaaagataccgtcgcctgcacccggcacaac
agcccgcaactgattgcccagggcagcgagtcggtatttgtgaacgacgcgccagcggcc
cgtatcgacgataaaaccgtgtgtggtgccactatcaaggaaggggcctcgacggtattt
ttcggctccgggcagggcacctatctggagattgccgaagagtttaccgcgctgcaacgc
gcgctgctgattgcggtggagtttctggtgccgcccagccgcggcatgttcagggggctg
gggaaactgttcacccgtgggccgatggcggtactaaaagggatgcgcgccggggcgctg
aaaacgctggaaggactgaaaagcgccgttaaatgtgccagtgaggggtttcgcaacagc
aggggactgtcgcgtgtcacggaagcggtgcgcggtttcctcaaagacccggtttatatc
gccagcggcgaggtgattgaatcccgtaccgatatcgcgctgggccagacgctgccgctg
gtgttcgaacgcacctaccgctctgcctcggtacacaccgggctgctgggccgcggctgg
cacgacagttggagcgaggtggcgacggtaacgcgcgacggcctcaacacccacgtggtc
atcacgctggcacagggctacgacatcgattttaccttccatcaggacgtacaggcggtg
tactgcccacactaccctgaatttaccctgcaccgccggggcgacggcttcagcctgtgg
caccgcgaccagcagacctggcgcgactttagcgtggtgcagggcgagcgccggttgctg
tcggccattcacgatagccacgacaaccgcattgaactggtgcgcgacccgaaaggctac
ctgcgccaggtgcgccacagcgacggcgtcaccctgctgctggtgtggcggggcgagtac
ctgcaccagatacaacgcatcgacggcggccagaagacgttgctggccgagtaccgccag
gacgaacagggccgactggtggaagccaacgccacccacgcctatcacctctactacgag
tacgacgccgcccatcggctgacccgctggcacgataacgaccagacctgggcgcgctac
gaatacgatacgcaggggcgctgcgtctacaccacctgcgccgacgggtttctgaccgcc
cgcttcgactacctgcccgaccgggtggtgatgaccgacggcctcggccagcgcagcgaa
ttcggctttaacgacctgcacctgatgagctgggaacaatccccgctcggtcacgtcacc
cgctacgagtacgacgaggtcggcaacctgctgcgggaaatctcgcccgccgggcgggtg
gtcgaattcggctatctggacgacaccgggcgggtcagcacctttaccgacgccagcggg
catcagtggcggtacgactacgacgacgcgctgcggctgtgcggcgtcaccgacccgctg
ggacgcgagtggcgctgggtgtatgacgccgagggtaacccggaacggctcaccggcccg
gaagccagcgaggtacgattcgcctggaaccgctacggcctgctgacccaggtcagcgac
gccgccggtgaggtgcaggcgcggttgcagtacgaccaccgccagcggctgctgagcgcc
accgatgccgagagccgcacccagcaaatgcgttacgacatgcaggaccgggtggtacag
tggcaacgggcggatggtgcccgtttccggctcggctaccgccgggccagctgggcactg
ccggagcaactgatacgcccggatgacaaggaagagcagcgccagtacgaccgccacaac
aacctgctgagctacgtggacggcaacggcgcgctgtggcgtcagagcttcggcccgttc
gacctgctgaccgcccgcaccgacgccgaaggccacacctggcgctacgcgtacgataaa
gagagccagcaactgacaacggttattgccccggacggcagccgctggcagtggtggctg
gacgccgacgggcgggtcgtccgcgagcgtgacatgaccggcaccgagacccactacggc
tacgacgaggacggcctgtgcgtcagcgtgcgcaacggcgaaggcgacacccgccacttc
ctctacgacgcccgcgggctgctgttgcgtgaaaccgcgccggacgacaccctgcactac
cggtacgatgcggtgggccgcctgaccgaggtctcgtcggccaccgcccatgtgcagctg
gactacgacctgcgcgaccgggtggtgcgcgaatggcacaacggcacgctgcttacccgg
caggttgatgacaacgcccgcaccgtcacccgcaccctgacctgggacggcgacgccggg
gacaccaccggcaccctcgcgccgctcaccagtctgttccattacacccgcaccggcgag
ctgcggcaggtgcagttgccggacggtgccgacctgaccctgacctatgacgcggcgggc
cgcgagtcacaccgccgcggcggcagcggctttgtccagcagcgggaatacgacgtgatg
ggctggctgacgcgggagatgagcggggcacagcacgacggccacctgctggcggcacag
acgcgggaataccgctacgacggtgccggtaacctgaccggggtgcgtcacaaccgcgac
gccgaaggttatcgtctggacgccaccggccgggtgcaggcagtgctgagcggcggtgcg
ggcaaaccggtggacaccaccgcccgcttccactacacccgcaccggtctgccgcaggag
gcagggcggcttaccgagtggcaggcgggcagactggttcagcacgatgacacccattac
cagtacgacagggccggacggcttatccgtaaacaggtggtgcagccgggctaccgcccg
caggtgtggcagtaccgctgggacagccgcaaccagctgcgggtggtggataccccgacc
ggcgaacgctggctgtaccgttacgacccgttcggtcgccgggtgggcaaacgctgcgac
cagaaagccgaagagacccgctaccagtgggacggcgaccagatagcggaaatccgccac
taccgccacggccagctcgtggcccgccgtcactgggtctacaacggctgggagctggtg
gtacagcagcgccagcacaccggcggcgactgggaaacggattttgtgaccagcagccag
aacggtactccacaggcgctgttcacaccggacggcaccctgcgctggcaggccccgaca
gccaccctgtggggccagcgtcaggcagaaaaatcggaaagtccggaccccggcctggcc
ttcgccgggcagctccgtgacagcgaaagcgggctatgctataaccgctttcggtactac
gacccggccggtgggtgttatgtctcgccagacccgatagggatagcggggggtgagaat
aactatggctacgtccagaatcccatgtgctgggttgatccgtttgggttggctggatgt
agttcataccttaatgcttggggagggagaaatgccaaagcatttaagaatttttggaat
aactcaagtcatgctgatttcatgaaagcttggaataatcctgctttcaaaaaaaatatc
aaagctagactacgaggtggcggtttaactaacagtggtgggtatcatgaatggcttcct
gtttcacagggagataaatttaaaaaaatgggattctcttttgaggagtatatgtctttg
acctcaccaaccaataaagttggattcttagacaaatttgggaattacggttctcacacc
agctacacaggtggtgtaacaaaggcatcagctcaagcacatagagatctgatcaatatg
gccaagttggcccaaacaaaatctggttatttaggggctgtccaaaaatggtcgggggag
catctaccatttggtcagtttgatttgccatcaggattttggaaataa

DBGET integrated database retrieval system