KEGG   Dickeya chrysanthemi: Dd1591_0428Help
Entry
Dd1591_0428       CDS       T00930                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dze  Dickeya chrysanthemi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG_N
Motif
Other DBs
NCBI-ProteinID: ACT05315
UniProt: C6CI69
Position
complement(495098..496621)
Genome map
AA seq 507 aa AA seqDB search
MTLFTTDYLEYYLTLVSWIVHNGIWAVLVSSGVFVLPFVAIIIDEWLRARTEGADEGNKG
VLSSMRIENRVWVAIVVVMFAGIPFIDVDLNTIRYDQARSAQCRISVPQPEDTGWSKSFS
TLNNQSAKVPVWWAFMHALSRAITSASVSAIPCGTDLRQMRMEINATRIDDPVLAQEIAD
FTHDCYGPARAKLFMTRPNLDKTQMHDVTWIGSTYFVSTAGFYDTYHARTPREGWAYDSH
RDAGLAQVPSGAGYPSCRQWWSDGGNGLRARLLAQVDPSLLNRIAGWAGFLSRTEVDDSV
IRTIASPHQQKLNQGSVYTDYGGQIDKTLPNIVTRAAGDIGMTVGGLAAFPALDVMRQGL
PMVLALLKMALVICIPLVLLVGTYNLKTTITVSVVQFALFFADFWFQLARWIDSTILDAL
YGWGWGWNRPHGNVDPMAGLSNTFGDMLLNFVMGTMFIVLPTFWIMALAWAGVRAGNVLQ
GFAGATADAKAAGAKGGDMVLKSVSKK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttttcaccaccgattacctggagtattacctgactctggtgagctggatcgtc
cacaacggtatttgggcggtattggtttccagcggcgtgtttgtcctccccttcgtggcc
atcatcatcgacgagtggctgagagcccgtaccgaaggcgctgatgagggcaacaagggc
gtgctgtcatcaatgcgcattgagaaccgggtatgggtggcaattgttgtggtgatgttc
gcaggcattccgttcatcgatgtcgacctcaacacgatcagatacgaccaggcgcgttcg
gcacagtgccggatcagcgtaccgcagcccgaagacactggctggtcaaaatccttcagc
accctcaacaaccagagcgccaaagtgccagtctggtgggccttcatgcatgcactctca
cgtgcgatcaccagtgcctcggtatcagctatcccatgcggcaccgacctgcggcaaatg
agaatggagatcaatgctacccgtattgatgacccagtactggctcaggaaatagcagac
tttacccacgattgctacggccccgcacgcgccaagctgttcatgactcgtcccaatctt
gacaagacacaaatgcacgatgtgacctggatcggctcgacctattttgtcagtacagca
ggcttctacgacacctatcacgccaggacaccgcgtgagggttgggcctacgacagccat
cgtgacgccggactggctcaggtgccaagtggtgctggctacccgagttgccgccagtgg
tggagcgatggaggaaacggcttgcgtgcacgtctgttggcacaggtcgatcccagctta
ctcaatcgcatcgccggctgggccgggttcctcagccgcacggaggtagatgactcggtt
atcaggacgattgcctcccctcaccaacagaaactcaaccaaggtagtgtctacacggat
tacggcggtcaaatcgataaaaccttaccgaatatcgttactcgcgctgcgggtgacatc
ggcatgacagtgggaggactcgccgcattcccggcattggacgtgatgcgccagggactg
ccgatggtgcttgcattactgaagatggcgctggtgatctgtatccctcttgtacttctg
gtaggcacttacaacctgaagacaacgataacggtcagcgtcgtgcagtttgcgctgttc
tttgcagatttttggtttcaactggcacgatggattgacagcaccatcctcgatgcactt
tacgggtggggttggggctggaatcggccgcacggcaacgtcgatccgatggcaggtttg
agtaacactttcggcgacatgctgctgaacttcgtcatgggcacgatgttcattgtatta
cccacattctggataatggctttggcttgggcaggcgtccgcgccggtaatgttcttcaa
gggttcgctggagctacagctgatgccaaagcagcaggagcaaaaggaggtgacatggtt
cttaaatccgtatcgaaaaaataa

DBGET integrated database retrieval system