KEGG   Dickeya chrysanthemi: Dd1591_0432Help
Entry
Dd1591_0432       CDS       T00930                                 

Definition
(GenBank) protein of unknown function DUF1525
Organism
dze  Dickeya chrysanthemi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1525 Thioredoxin_3
Motif
Other DBs
NCBI-ProteinID: ACT05319
UniProt: C6CI73
Position
complement(499311..499769)
Genome map
AA seq 152 aa AA seqDB search
MINFAVLHMLASASIYSFSLHRLATVLLTALLSPLVQAADLLAVTDTRHPMQNLGNTRLI
ELDRPSRIEAELAANLPKDPTYATAIVQQRLKEGGTALQQRINEAYQNVVDAWSLGITTL
PAVIVDQRYVVYGEPDVAKAVARIEAYTRTQQ
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattttgcggtactccatatgctggcttctgcttccatctattccttttcgctg
cataggcttgctactgtcttgctcactgcgctgctgagtccactcgtacaggctgcggat
ctactggccgttactgacacccggcacccgatgcaaaacctgggcaacacccggctcatc
gaactggaccgcccatcacgcatcgaagccgagctggcagccaacctccccaaagatcca
acctacgccactgcaatcgtgcaacaacgcctgaaagaaggcggcaccgccctgcagcag
cgcatcaacgaggcctatcagaacgttgtcgatgcctggagcctgggcatcaccaccctt
cccgccgttatcgttgatcaacggtatgtggtttacggagagcctgacgtcgccaaagcg
gttgcgcgtatcgaagcttacacgaggactcagcaatga

DBGET integrated database retrieval system