KEGG   Dickeya chrysanthemi: Dd1591_0436Help
Entry
Dd1591_0436       CDS       T00930                                 

Definition
(GenBank) putative secreted protein
Organism
dze  Dickeya chrysanthemi
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT05323
UniProt: C6CI77
Position
complement(504394..504831)
Genome map
AA seq 145 aa AA seqDB search
MHSNWTKSLAIMVTVTVLTSCATSKEELLPHGGRTMQDIWQQESGNGGSPGQMAYRQLLD
ARQSLRRPLSHADVKTVSTEQESYTRTAANDVRSQFQRLPNPDLLMYVFPHLAGTDPVPV
PGYTTIFPLYQRVQYAMPGERTEDY
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgaactggactaaatcgttggcaatcatggtaacggtaaccgtattgaccagt
tgcgctaccagcaaggaagagctgttgccccatggcggtcgaaccatgcaggacatctgg
cagcaggagagcggcaatggaggcagtccgggtcagatggcataccgtcaactgctcgat
gcccgtcagagcttacgtcgcccactcagccatgcagatgtgaaaacagtttccactgag
caggaaagctacacgcgtaccgccgccaatgatgtacgcagccagtttcaacggctgccc
aatcccgacttgttgatgtacgtgttcccgcatctggcggggacagacccggttccggtg
ccgggttacaccaccattttcccgctctatcagcgtgtacagtacgcgatgccaggggaa
cgtacggaggactactga

DBGET integrated database retrieval system