KEGG   Dickeya chrysanthemi: Dd1591_0448Help
Entry
Dd1591_0448       CDS       T00930                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dze  Dickeya chrysanthemi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG-D_C TrwB_AAD_bind T4SS-DNA_transf DUF87
Motif
Other DBs
NCBI-ProteinID: ACT05335
UniProt: C6CI89
Position
complement(513273..515432)
Genome map
AA seq 719 aa AA seqDB search
MAKSQPVEVLLRPAVELYTVAVCAGAVLLCLTAPWSLALSPDIGIGSALAFVVFGALRWR
DAQVILHYRRNIRRLPRYVMTSRDVPVSGQRLFIGRGFLWEQKHTHRLMQTYRPEFRRYV
EPTPAYQLARRLEERLEFAPFPLSQLPRITTWDVPFNPVRPQPPVGGLPRLHGIEPDEVD
VSLPLGERVGHSLVLGTTRVGKTRLAELFITQDIRRKNHLGEHEVVIVFDPKGDADLLKR
MCVEAKRAGRENEFYVFHLGWPEISARYNAVGRFGRISEVATRVAGQLSREGNSAAFREF
AWRFVNVIARALIELGQRPDYLLIQRHVINIDALFIEYAQHYFARTEPKAWEVIVQIEAR
LNENNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIVQLLAPNYSDLSDPRPIFDWLQIIRKRAIVYVGLDALSDAEVAAAVGNSMFSD
MVSVAGHIYKFGIDDGLPGASADTKVPINVHADEFNELMGDEFIPMVNKGGGAGIQITAY
TQTLSDIEARIGNRAKAGLVVGNFNNLFMLRVRETATAELLTKQLPKVEVYTTTVASSVT
DSSDIHAKTDFTSNTQDRISLSSVPMIEPSHVVQLPKGQCFALLQGGNLWKVRMPLPSPD
PDEVMPTDLQQLAGYMRQSYTDAGQWWQNQGTPVLQEQVLPPELLDENLDSTADQGRAP
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtcccaaccggtcgaggtactgctgcgtccagcagtggaactctataccgtt
gcggtttgcgccggggcagtactgctgtgcctgacagctccgtggtctctcgcgctaagt
ccagacatcggtatcggcagcgcactggccttcgtcgtctttggcgcactgcgctggcgt
gatgcacaggtgatcctgcattaccgccgtaatatccgtcgcctgccacgctatgtgatg
accagccgtgacgtgcccgtcagtggacaacgactgtttatcggtagggggtttctgtgg
gagcaaaagcacacccaccggttgatgcaaacctaccgacctgagttcaggcgttatgta
gaaccgacacccgcctaccagttggcccgacgtctggaggagcggctggaattcgcacca
tttccgttgtcacaattgccccgtatcaccacctgggatgtaccgttcaacccggttcgg
cctcagcctcctgtcggcggactgccgcgactacacggtatcgagcctgatgaggtggat
gttagcctgcccttgggcgagcgcgtcggccattctctagtattgggcaccacgcgagtg
ggtaaaacgcggctggccgaattattcatcacccaggacattcgccgaaagaatcacctc
ggcgagcatgaagtggttattgttttcgatcctaaaggtgacgcggatctgctcaagagg
atgtgcgtcgaggcaaaacgcgcaggcagagaaaacgagttctatgtgttccatcttggg
tggccggagatcagcgcacgttacaatgcggtggggcgttttggtcgtatcagcgaagtc
gccacccgcgtcgcaggacagctttccagggaaggcaactcggcggccttcagggaattc
gcctggagatttgtcaatgtcatcgccagggcgttgatcgaactgggtcagcgcccggac
tacctgctcatccaacgccacgtcatcaatatcgatgcgttgttcatcgagtacgcccag
cactacttcgcccgcacagaaccgaaagcctgggaggtcattgtccagatcgaagccagg
ctcaacgagaataacattcccagaaatatgatcggccgcgaaaagcgtgtggtcgccctt
gagcaatacctcagccaggcccgtaactacgatcccgtactggatggcttgagatccgct
gttcgctacgacaaaacgtacttcgacaagatcgtcgccagcctgctacccctgcttgaa
aaactcaccagcggtaaaatcgtccaattgctggctccaaactattcggatctgagcgat
cccagaccgattttcgattggctgcaaatcatcaggaaacgcgcaatagtctatgtcggt
cttgatgcactatccgatgcagaagtcgcagcagcagtaggcaactcgatgttcagcgat
atggtctctgtggccggacacatctataaattcggtatcgacgacggtctgccgggtgca
tctgctgacaccaaggtgccaatcaacgtccatgccgatgaattcaatgaactgatgggc
gatgagttcatccctatggtcaacaaagggggaggcgctggcatccagatcaccgcctat
actcaaaccctcagtgatattgaagcccgcataggcaatcgcgccaaagccggcctggtc
gtcggcaatttcaacaatctgttcatgttacgcgtgcgcgaaacagccaccgctgagcta
ctcacgaaacagttacccaaggtagaggtctacaccaccactgtggccagcagcgtgaca
gacagctccgacatccacgcaaaaaccgacttcaccagcaacacacaggatcgcatcagt
ctatcgagcgtgccgatgattgaaccgtcccatgtggttcaacttccgaaagggcagtgc
ttcgcgctgctgcagggtggcaatctctggaaagtccgcatgccactgccctcccctgac
ccggatgaagtcatgccgaccgatctgcagcaattggcaggctacatgcgccagagctac
accgatgccgggcaatggtggcagaaccaggggacccccgtgttgcaggagcaagtactg
ccacctgagctgctcgatgaaaacctcgacagcaccgccgaccagggtagagcaccatga

DBGET integrated database retrieval system