KEGG   Dickeya chrysanthemi: Dd1591_0451
Entry
Dd1591_0451       CDS       T00930                                 

Definition
(GenBank) putative secreted protein
Organism
dze  Dickeya chrysanthemi
SSDB
Motif
Pfam: Glutaredoxin
Other DBs
NCBI-ProteinID: ACT05338
UniProt: C6CI92
Position
complement(516548..517255)
AA seq 235 aa
MKRQMTLLIAATLTMSAMAQPPTTMQSRIVPVQGGQHRDERLAQEWGLKTDEWQRYRELM
EGPIGTYSPNLDPLSALGIEARSDEERQRYAELQVKAEARRVEKLLAYQRAYDEAWQRLN
PGMQRVSLPDAGLSRNAVTGNGRTAVFVKDNCQPCTQLVQRLQASGTAFDLYMVGSHQDD
ALIRAWARGAQIDPEQVRNGTITLNHDAGRWLSLGLPGDLPASIRQVNGRWQRQP
NT seq 708 nt   +upstreamnt  +downstreamnt
atgaaacgccagatgacgctcctcatcgcggccactctgacaatgtcagcgatggcacag
ccacccaccacgatgcagtcccgcatcgtaccggttcagggcggacaacatcgggatgaa
cgtctggctcaggagtggggcctgaagaccgatgaatggcagcgataccgcgaactgatg
gagggaccaatcggtacttactcacccaacctcgatccgctctctgcactgggtatcgag
gcacgcagtgatgaagagcgacaacgttatgctgaactgcaagtgaaagcagaagctcgt
cgcgtcgaaaagctgctggcctatcagcgcgcatacgacgaagcgtggcaaagactcaac
cctggcatgcagcgggtaagtttgcctgatgccgggctcagcagaaacgcggtgaccggc
aacggacgcacggcggtgttcgtcaaggacaattgccagccatgcacccagcttgtgcag
cgtttacaggcctccggcaccgcatttgacctgtatatggtcggctcacaccaggacgat
gcgctcatccgcgcctgggccagaggtgcgcagattgaccctgagcaggtacgcaatggc
accattactctgaaccacgacgccggtcgctggttgtctctggggctgcccggagacctg
cccgccagtatcagacaggttaatggccgatggcagcgtcagccctga

DBGET integrated database retrieval system