KEGG   Dickeya chrysanthemi: Dd1591_0562Help
Entry
Dd1591_0562       CDS       T00930                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
dze  Dickeya chrysanthemi
Brite
KEGG Orthology (KO) [BR:dze00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Dd1591_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ACT05444
UniProt: C6CJ65
Position
complement(641199..641576)
Genome map
AA seq 125 aa AA seqDB search
MMNAPRVCIQVQSFYVEAQSQPEEGRFVFAYTITIRNLGRHDVKLLSRYWMITNGNGKQT
EVQGEGVIGLQPVIQPGSEFQYTSGAILETPMGTMEGHYQMIDHQGETFQVPITVFRLAI
PSLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatgcgccccgagtgtgtatacaggttcagagcttctatgtggaagcacaatct
cagccggaagaaggtcgtttcgtcttcgcgtataccatcactatccgcaatctgggtcgt
catgacgtcaaactgcttagccgttactggatgattaccaacggtaacggcaagcaaacc
gaagtccagggtgaaggcgtaatcggcctacaacctgttattcaaccgggcagcgaattc
caatacaccagcggtgctattctggaaaccccgatgggcaccatggaaggccactaccag
atgattgaccatcagggtgaaacatttcaggttcctattacggtattccgcctggccatc
ccttcactgatacactga

DBGET integrated database retrieval system