KEGG   Dickeya chrysanthemi: Dd1591_0887Help
Entry
Dd1591_0887       CDS       T00930                                 

Definition
(GenBank) Acireductone dioxygenase ARD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00270  Cysteine and methionine metabolism
dze01100  Metabolic pathways
Module
dze_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dd1591_0887
Enzymes [BR:dze01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Dd1591_0887
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Dd1591_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 HTH_16
Motif
Other DBs
NCBI-ProteinID: ACT05766
UniProt: C6CLY1
Position
1027572..1028114
Genome map
AA seq 180 aa AA seqDB search
MSALTIFSDTDAGQPVWQSHDADAIVQQLSAINVRFERWQADRDLIANPSTEEVLAAYQH
EIDKLVAEKGYQSWDVISIRADNPQKAALRTKFLSEHTHAEDEVRFFVEGAGLFCLHVNG
QIFQILCEKNDLLSVPAGIPHWFDMGSEPHFTAIRLFNNPDGWIAHFTGDTIADAYPKLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccttaactattttcagtgataccgatgccggtcagccggtgtggcaaagccac
gatgccgatgcgatcgttcagcaactgagcgctatcaatgtgcgttttgaacgctggcag
gctgaccgcgacctgatcgccaacccttctaccgaggaggtgctggcggcgtatcagcat
gagatcgataaactggtggcggagaaaggctatcagagttgggatgtcatcagcatacgt
gccgataacccgcaaaaagcggcattgcgtaccaagtttctgtcggaacatacccacgcc
gaagatgaagtgcgtttcttcgttgaaggggccggcttgttctgcctgcacgtaaacggc
cagattttccagatcctgtgtgaaaagaacgatctgctgtcggtgcctgccggtataccg
cattggttcgatatgggttctgaaccgcatttcacggccattcgtttgttcaacaacccg
gatggctggattgcacacttcaccggcgataccatcgccgacgcgtacccgaaactggcg
taa

DBGET integrated database retrieval system