KEGG   Dickeya chrysanthemi: Dd1591_1104Help
Entry
Dd1591_1104       CDS       T00930                                 

Definition
(GenBank) cysteine desulfurase IscS
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00730  Thiamine metabolism
dze01100  Metabolic pathways
dze04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:dze00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Dd1591_1104
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Dd1591_1104
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dze03016]
    Dd1591_1104
   03029 Mitochondrial biogenesis [BR:dze03029]
    Dd1591_1104
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:dze02048]
    Dd1591_1104
Enzymes [BR:dze01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Dd1591_1104
Transfer RNA biogenesis [BR:dze03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    Dd1591_1104
 Prokaryotic Type
    Dd1591_1104
Mitochondrial biogenesis [BR:dze03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    Dd1591_1104
Prokaryotic defense system [BR:dze02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   Dd1591_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACT05976
UniProt: C6CPC1
Position
1276179..1277393
Genome map
AA seq 404 aa AA seqDB search
MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAE
LVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFE
VTYLAPQRNGIIDLKELEAAMRDDTIVVSIMHVNNEIGVVQDIATIGDMCRSRGIIFHVD
ATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMR
SGTLPVHQIVGMGEAYRIAKEEMAEEAVRLRNLRNRLWNGINDIEEVYLNGDLEQGAPNI
LNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMSDELAHSSIRFSLGRF
TTEEEIDYTIDLVRKSIGRLRDLSPLWEMFKQGVDINSIEWAHH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaccgatttatctggattattccgccaccacgccggtcgatccgcgtgtggct
gaaaaaatgatgcagtttctgaccctggacggtacgtttggcaacccggcctcacgttcc
caccgtttcggctggcaggctgaagaagcggtggatatcgcccgtaatcagatcgctgaa
ctggtcggcgcagacccgcgtgagatcgtctttacttccggcgcgaccgagtccgacaac
ctggctatcaaaggtgcggcgaatttctaccagaagaagggcaagcacatcattaccagc
aagacggaacacaaagccgtgctggatacctgccgtcaactggagcgcgaagggtttgaa
gtgacgtacctggcgccgcagcgcaacggtattatcgatctgaaagagctggaagccgct
atgcgtgacgacaccatcgtggtgtccattatgcatgtgaataacgaaatcggcgtggtg
caggatatcgccaccatcggcgacatgtgccgtagccgcggcatcattttccatgttgat
gccacccagagcgtaggcaaattgccgattgacctcagccaactgaaagtcgacctgatg
tctttctccggccacaagatttacggcccgaaagggattggcgcgctgtatgtgcgtcgc
aagccgcgcgtgcgcatcgaagcgcagatgcatggtggcggccatgaacgcggtatgcgt
tccggcaccctgccggtgcaccagattgtggggatgggtgaagcttaccgcatcgccaaa
gaagagatggccgaagaagcggtacgtctgcgcaacctgcgcaatcgcctgtggaacggt
atcaacgatatcgaagaagtgtacctgaacggtgacctggagcagggcgcgccgaatatc
ctgaacgtgagtttcaactacgtggaaggtgagtcgctgatcatggcgctgaaggatctg
gcggtgtcttccggctcggcctgtacatccgccagcctggagccttcctatgtgttgcgc
gcgctggggatgagcgatgaactggcgcacagttccatccgtttctcactgggtcgcttc
accactgaagaagaaattgactacaccatcgatctggttcgtaaatccatcggccgtctg
cgtgatctgtctccattgtgggaaatgttcaagcagggcgtggatatcaacagcatcgaa
tgggcgcatcattaa

DBGET integrated database retrieval system