KEGG   Dickeya chrysanthemi: Dd1591_1483Help
Entry
Dd1591_1483       CDS       T00930                                 

Definition
(GenBank) putative conjugal transfer protein
Organism
dze  Dickeya chrysanthemi
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT06341
UniProt: C6CEZ0
Position
complement(1702797..1702937)
Genome map
AA seq 46 aa AA seqDB search
MKSSIVFLMLCILTGCAGHQHDLPPVSGDPQPVNSPAIIQELTTHV
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccagcattgtctttctgatgctgtgcatcctcacgggctgcgcagggcatcaa
cacgaccttccgccggtatccggcgatcctcaaccggtcaattcccccgcgattattcag
gagctgacaacacatgtctga

DBGET integrated database retrieval system