KEGG   Dickeya chrysanthemi: Dd1591_1857Help
Entry
Dd1591_1857       CDS       T00930                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00010  Glycolysis / Gluconeogenesis
dze00071  Fatty acid degradation
dze00350  Tyrosine metabolism
dze00625  Chloroalkane and chloroalkene degradation
dze00626  Naphthalene degradation
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
dze01130  Biosynthesis of antibiotics
dze01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd1591_1857
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dd1591_1857
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Dd1591_1857
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dd1591_1857
   00626 Naphthalene degradation
    Dd1591_1857
Enzymes [BR:dze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dd1591_1857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Lamprin
Motif
Other DBs
NCBI-ProteinID: ACT06708
UniProt: C6CGD9
Position
2124684..2125832
Genome map
AA seq 382 aa AA seqDB search
MSSAFYIPALNLMGEGALEEAARQIQLQGFKHALIVTDGVLNKIGVAASVQQLLKKYQVD
SAIYDGVQPNPTVANVDAGLKILKANNSDCVVSLGGGSSHDCAKGIALLAANGGEIADYE
GVDVSAKPQLPLIGINTTAGTASEMTRFCIITDEVRHVKMAIVDKNVTPVMSVNDPVLMV
GMPASLTAATGMDALTHAIEAYVSTAANPITDAVAIKAIELIRDHLRDAVKDGKNMVARE
QMAYAQFMAGMAFNNASLGYVHAMAHQLGGFYNLPHGVCNAVLLPHVERYNASVAAPRLK
DVAVALGVDVAGLSDQQAAEAAITAISRMASDVGIPAGLKDLGVKEEDFNILADNALKDA
CGLTNPKKATHAEIVGIFAAAF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgcattttacattcccgccttaaacttgatgggcgaaggtgcattagaggaa
gcggcaaggcagattcagttacagggtttcaaacacgccttaatcgtcacggatggcgtg
ctgaacaaaatcggtgttgcggcttccgtgcagcaattgctgaaaaaatatcaggttgat
agcgccatttacgatggcgtgcagccgaacccgactgtggccaatgtggatgcaggtctg
aaaattctcaaagcgaacaacagcgattgcgtcgtctcgctgggtggcggttcttcgcat
gactgcgccaaaggcatcgcgttgctggcggccaatggcggcgaaatcgccgactatgaa
ggtgtggatgtgtccgccaaaccgcagttgccgctgattggtatcaacaccacggcaggc
accgcttctgaaatgacccgtttttgcatcattaccgatgaagtgcgtcacgtgaagatg
gcgatcgttgataagaacgtgacgccggtgatgtccgtcaatgatccggtgctgatggtc
ggtatgccggcgtcgctgacggccgccaccggtatggatgcgctgacccacgcaattgaa
gcgtatgtgtcgacggcggctaacccgattaccgatgccgtggcgattaaagcgattgaa
ttgattcgcgaccatctgcgcgatgcggtgaaagacggtaaaaacatggtggcgcgtgaa
cagatggcgtatgcccagttcatggcgggcatggcgtttaataacgcctcgctgggttat
gtccatgccatggcgcaccagttgggcggtttctacaatctgccgcacggggtatgcaac
gccgtgctgctgccgcacgttgagcgttataacgcctctgtcgccgcaccgcgtctgaaa
gatgtcgccgtcgcgttgggggtggatgttgccgggctgagcgaccagcaggcggcggaa
gccgctatcaccgccatcagccggatggcgagtgacgtcggtatcccggcagggctgaaa
gacctgggcgtgaaagaagaagacttcaatattctggccgataacgcgctgaaagatgcc
tgcggtttgaccaacccgaaaaaagccactcacgcggaaatcgtcggaatttttgccgcc
gcgttctaa

DBGET integrated database retrieval system