KEGG   Dickeya chrysanthemi: Dd1591_2804
Entry
Dd1591_2804       CDS       T00930                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
dze  Dickeya chrysanthemi
Brite
KEGG Orthology (KO) [BR:dze00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dze02044]
    Dd1591_2804
Secretion system [BR:dze02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Dd1591_2804
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACT07628
UniProt: C6CNV3
Position
complement(3186710..3188476)
AA seq 588 aa
MSLEHFFRDELAYLRLQGREFAKAHPELTRFLSEQTTDPDVERLLEGFAFLTGSLRAKIE
DEFPELTHGLLGMLWPNYLRPVPSMTIMQFSVLPGAIAQPAFVARGCELDSLPIDDVVCH
FQTCHDAWIYPADIHRINAQSGNDMSAITLDIGLHGPLSLGDLQLDKLRFFLGGDRYTAY
ELYFWIASQLSHIELEIDGKRFRQQANVLKTVGFEREDAMLPYPGNVYSGYRILQEYFCF
PESFLFFQLSGASWPNQPLMVTDFKLHFCFDRPLPAELKIRPDSFMLNCVPAINLFRHDS
EPINLDGRQTDYPLKASYRHADSFEIFSIDKVEGWVEGNSGRARGIPRLYQPFESFQHQI
ERAKGRLALYYRIRVREAVSGDGFEHLLSFVRGDEKEVIDLDESISVSLTCTNRSRAAQL
PVGAICVPTGNSPSFATFRNLIRPTRPLRPALDGSLHWTLISNLSLNYVSLLRRDALVQI
LRTYDFPALHDKQAEQASRKRLAGIETIETTPVDRLVQGMPVRGLKSVLSVRQSAFASEG
ELYLFSTVLAHFFSLYASVNAFHLLEVVNIDNKERYRWPVQIGQHSMM
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgtcgctggaacatttcttcagggatgaactcgcttatttgcgcctgcaagggcgcgaa
ttcgccaaagcacaccctgaacttacccgatttttgtcagaacagaccacggatccggat
gtcgagcggttgctggaaggcttcgcctttttgaccggcagtttgcgggcgaagatcgag
gatgagtttccggagctgacgcacggcctgctgggtatgctgtggccgaactatttgcgc
ccggtccccagcatgaccatcatgcagttttcggtactgcccggcgccatcgcgcagccg
gcgttcgtggcgcgcggctgcgagctggacagcctgccgatcgacgatgtggtctgtcat
ttccagacctgccacgatgcctggatctacccggcggatatccaccggatcaacgcgcaa
agcggcaacgacatgtccgccatcacgctggatatcggcctgcacgggccgttgtcgctg
ggggatttgcagctcgataaactgcgtttcttcctgggcggcgaccgttacaccgcctat
gaactctatttctggatagccagccagttatcgcacattgagctggaaattgacgggaaa
cgctttcgccagcaggcgaatgtgctgaaaaccgtcggttttgagcgcgaagacgcgatg
ctgccgtatcccggcaacgtctactccggctaccgcatcctgcaggagtatttctgtttt
ccggaaagttttctgttcttccagttgtccggcgccagttggcctaaccagccgttgatg
gtgacggatttcaaactgcatttctgctttgaccggccgctgccggcggaactgaaaatc
cgtccggattcgttcatgctcaactgcgtgccggccatcaatctgttccgccatgacagc
gaaccgatcaacctggatggtcgccagacggattacccgctcaaagccagctatcgccac
gccgacagcttcgagattttttccatcgacaaagtggaaggctgggtggagggcaacagc
gggcgcgcgcgcggcattccgcggctctaccagccgttcgaaagtttccagcaccaaatc
gaacgagccaaagggcggctggcgctgtattaccgcattcgggtgcgtgaagcggtcagc
ggcgacggctttgagcatttgctgtcgtttgtgcgcggcgacgagaaagaggttatcgat
ctggatgagtccatttcggttagcctgacctgcaccaaccgctcgcgggcggcgcagttg
ccggtgggcgccatctgcgtgccgaccggcaattcgccgtctttcgctaccttccgcaac
ctgattcggcccacccgcccgctgcgcccggcgttggacggcagcctgcactggacgctg
atctccaacctgtcgctgaactatgtgtcgctgctgcgccgtgatgcgctggtgcagatc
ttgcgtacctacgactttccggcgttgcatgacaagcaggcggagcaggcgtcgcgcaag
cggctggcggggatagaaacgattgaaaccacaccggtggaccggctggtgcaggggatg
ccggtgcgcgggctcaagtcggttttgtcggtgcggcagtcggcgttcgccagtgaaggc
gaactctatctgttcagcaccgtgctggcgcatttcttctcgttgtacgccagcgtcaac
gccttccatctgctggaagtggtcaatatcgataacaaggagcgctaccgatggccggta
cagataggtcagcactcgatgatgtga

DBGET integrated database retrieval system