KEGG   Dickeya chrysanthemi: Dd1591_2805
Entry
Dd1591_2805       CDS       T00930                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
dze  Dickeya chrysanthemi
Brite
KEGG Orthology (KO) [BR:dze00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dze02044]
    Dd1591_2805
Secretion system [BR:dze02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Dd1591_2805
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACT07629
UniProt: C6CNV4
Position
complement(3188479..3188910)
AA seq 143 aa
MPSLSAWERGSAASLFDRIRGEERRSSPETELEDLIASVKRQLDQVLNTRPGSCRSAPEL
GVIDFNDATQGGADIRGKIREAIRQCICRFEPRIVHVDVSASDYLSNPLEMSFQVTAHVR
LEELEQVTSFNIHMDSHRHYRMM
NT seq 432 nt   +upstreamnt  +downstreamnt
atgccgtcgctctctgcctgggagcggggatctgcggccagcctgtttgatcgtatccgg
ggagaggagcgccgttcctctcccgaaacggagttggaagacctgatcgcgtcggtgaaa
cgccagcttgatcaggtactgaatacgcgccccggcagttgtcgcagcgcacccgagctt
ggcgtgattgattttaatgacgccacgcagggcggcgcggatatccggggcaaaatccgt
gaagcgatccgacagtgtatctgtcgctttgaaccgcgcattgtccatgtggacgtcagt
gcatcggactatctgtccaacccgctggagatgtcgtttcaggtcaccgcacatgtgcgg
ctggaagaactggagcaggtcacctccttcaatattcatatggacagccaccgccattac
agaatgatgtga

DBGET integrated database retrieval system