KEGG   Dickeya chrysanthemi: Dd1591_2912Help
Entry
Dd1591_2912       CDS       T00930                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00020  Citrate cycle (TCA cycle)
dze00640  Propanoate metabolism
dze00660  C5-Branched dibasic acid metabolism
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
dze01130  Biosynthesis of antibiotics
dze01200  Carbon metabolism
Module
dze_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dze_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dd1591_2912
   00640 Propanoate metabolism
    Dd1591_2912
   00660 C5-Branched dibasic acid metabolism
    Dd1591_2912
Enzymes [BR:dze01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dd1591_2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACT07734
UniProt: C6CPT2
Position
complement(3314709..3315875)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KLVNSKEEIRAFAENWLGKRLVTYQTDANGQPVHQILVEGATDIDKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPQPYQGRELAFKLGLNGKQVAQFTKI
FMGLATLFLERDLALVEINPLVITKQGDLICLDGKLGADGNALFRQPELREMRDHSQEDA
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGAPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAQK
LADSGLNIIAATSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgagtatcaggcaaaacagctctttgctcggtatggtttaccggcacct
accggttacgcctgcacaacaccgcgcgaagcggaagaagcggcctccaagattggctcc
ggcccatgggtcgtgaaatgtcaggtacatgccggcggtcgcggtaaagccggcggtgta
aaactggtgaacagcaaagaagaaattcgtgctttcgctgaaaactggctgggtaaacgt
ttggtgacttaccaaacggatgccaatggtcagccggttcatcagattctggtggaaggc
gctacggatattgataaagaactttatctgggagcggttgttgaccgtggtactcgtcgt
gttgtctttatggcttccaccgaaggcggtgttgaaattgagaaggttgccgaagaaacg
ccgcacctgattcataaagtcgcactggatccgttgacggggcctcagccgtatcagggg
cgtgagttggcgttcaagctgggcctgaatggcaagcaggttgctcagttcaccaaaatt
ttcatgggactggcgacattgttcctggagcgcgatctggcgctggtagaaattaaccca
ttggttatcaccaaacagggcgatttgatttgtctggacggcaaactgggggctgacggc
aatgcgttattccgccagccggaactgcgtgaaatgcgtgaccactctcaggaagatgcg
cgtgaagcacatgccgcacagtgggaactgaactatgtcgcgttggacggcaatatcggt
tgtatggtgaatggcgcaggtctggctatgggcaccatggacatcgtgaaactgcacggc
ggcgcaccggccaacttccttgacgtgggcggcggcgcaaccaaagaacgtgtgaccgaa
gcgttcaaaatcatcctgtctgatgacaaggtgaaagcggtatttgtcaatattttcggt
ggtatcgttcggtgcgacctgattgccgacggtattatcggtgcggtagccgaagtgggt
gttaacgttccggttgtcgtgcgtctggaaggtaataatgccgaactgggggcgcaaaaa
ctggcggatagtggtttgaacatcattgctgcgaccagcctgacggatgcggctcagcaa
gtggttgctgcagtggagggtaaataa

DBGET integrated database retrieval system