KEGG   Dickeya chrysanthemi: Dd1591_2913Help
Entry
Dd1591_2913       CDS       T00930                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00020  Citrate cycle (TCA cycle)
dze00310  Lysine degradation
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
dze01130  Biosynthesis of antibiotics
dze01200  Carbon metabolism
Module
dze_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dze_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dd1591_2913
  Amino acid metabolism
   00310 Lysine degradation
    Dd1591_2913
Enzymes [BR:dze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dd1591_2913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACT07735
UniProt: C6CPT3
Position
complement(3316015..3317241)
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPALEAGVLEVV
LEGEGATVTSRQVLGRLRPGDNSGKETSEKAQSKESTPAQRHTAGLEDENNDALSPAIRR
LIAEHDLDASAIKGSGVGGRITREDVEKHLAGQKSAAKPAEASAAASAQPAPALASRSEK
RVPMTRLRKRVAERLLEAKNNTAMLTTFNEVNMQPIMDLRKQYGEAFEKRHGVRLGFMSF
YIKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLKDVDLLGMAEIEK
KIKELAVKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VDGQVVILPMMYLALSYDHRLIDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgtccctgacctgccggaatccgtagctgacgcgacagtc
gctacctggcacaagaaaccgggcgatagcgtccagcgtgatgaagtgctggttgagatt
gaaaccgacaaagtggtgctggaagtgcctgcgcttgaagcgggcgtattggaagtggtg
ctggaaggggaaggcgcgacggtgacatcacgccaggtgttggggcgtctgcgtcctggc
gataattccggcaaagaaaccagcgaaaaagcacaaagtaaagagtctactccggcacag
cgccacaccgccgggttggaagatgagaataacgacgccttgagcccggctattcgtcgc
ctgattgctgaacatgatctggatgcctcggcgattaagggcagcggcgtcggcgggcgt
atcacgcgtgaagatgtggaaaaacacctggcagggcagaagtcggcggctaagccggct
gaggcatctgccgctgcgtcggcgcagcctgctccggccttggcgagccgcagcgagaaa
cgtgttcctatgacccggttgcgcaaacgcgttgctgagcgtctgctggaagcgaaaaac
aataccgcgatgttgactacgtttaatgaagtcaacatgcaaccgatcatggacctgcgc
aagcaatacggtgaggcgtttgaaaaacgtcatggcgttcgtctgggtttcatgtccttc
tatatcaaagcagttgtagaagcactgaaacgttatccggaagtgaatgcatctattgat
ggcgaagatgtggtttaccacaactacttcgacgtcagtatcgccgtgtctactccgcgc
ggcctggttacaccggtgctgaaagatgtcgatctgctgggtatggctgagatcgagaag
aaaatcaaagaactggcggtgaaaggtcgtgacggcaaactgaccgtcgaagagctgacc
ggcggcaacttcaccatcactaacggcggcgtgtttggctcgttgatgtcgaccccgatt
atcaatccgccgcagagcgcgattctggggatgcatgccatcaaagatcgtcctatggcc
gttgacggccaggttgtgatcctgccgatgatgtatctggcgctgtcttacgaccatcgt
ttgatcgatgggcgggaatcggtcggtttcctggttaccgtgaaagaaatgctggaagac
ccggctcgcttgctgctggatgtctaa

DBGET integrated database retrieval system